KEGG   Bacillus halodurans: BH1263Help
Entry
BH1263            CDS       T00039                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bha  Bacillus halodurans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bha03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358233..1359408
Genome map
AA seq 391 aa AA seqDB search
MTDGRSLTNENEHLEKSYLKGEVVQIIFRNEENQYTVALVRVHESSDDVKEKTMTVVGLL
PKLEVHDTFTFYGSFKEHPRFGEQYVVDDLRREVPKTSQGIIRYLSSDRFPGIGKKTAQQ
IVDTLGEQALSRIVEDESALDAVPKLSKEKAKLLREQLLEQQGFEQVLTALSDYGFGVEL
SMKVFNVYKLHALEIIRTNPYQLIYDVEGIGFRRADRLGAAIGIKGNHPDRIQAGCHFVL
QEWCLQEGHIFLTKEALIPKIIQLLSSPAEPIEEQGVLEQMQMMEEEGALIVEEERVYIK
SLYFAEKGIVSSIVSLLHQEVQEEFPASEFLQKLGELEEELKIEYAPSQREAIETALSSP
FMILTGGPGTGKTTVIKGIVELYARLSRTFA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgggcgctcattgaccaatgaaaatgagcacctcgagaaaagctatctcaaa
ggggaagtcgttcagatcatctttcggaacgaagagaaccagtacacggttgcgctagtt
cgtgtccacgagtcgtctgatgatgtgaaagagaaaacgatgaccgtggttggtttgcta
ccgaagctagaagttcatgatacgtttaccttttatggttctttcaaagagcaccctcgt
ttcggtgaacagtacgttgtggacgacttgcgccgcgaagtaccgaaaacgtcacaaggg
atcattcgttatttgtcgagcgacagatttccaggcatcggaaaaaagacagctcagcaa
attgtagatacacttggagaacaagcgttgtcacgaattgtagaggatgaatcggccctt
gatgccgtaccaaagctttcaaaagagaaagcgaaactgcttcgagaacagcttttagag
cagcaaggttttgaacaagttttgaccgctttatccgattacgggtttggggtggagttg
tcgatgaaagtatttaatgtctacaagcttcacgcccttgaaatcattcgcacgaatcca
taccaactcatctatgatgtggagggaataggattccgtcgtgcagatcgtcttggagca
gccattggcattaaaggcaaccatcccgaccgaattcaagccggctgtcacttcgtttta
caagagtggtgcttacaagaagggcacatttttttgacgaaggaagcgctcattcctaag
attattcagcttttatcatcaccagctgagccgattgaggagcagggtgtattagagcag
atgcaaatgatggaagaagaaggagctctcatagttgaagaggagcgcgtgtatataaaa
tcgttatactttgcagaaaaaggaattgtatcaagcatcgtttcgctacttcatcaggaa
gtacaagaggagttccctgcttcagaatttttgcaaaagcttggagagttggaggaagag
ctgaaaattgaatatgccccgtctcaacgggaggcgattgaaacagccctttcttcaccg
tttatgattttaaccggagggcctgggacggggaaaacgacggtcataaaagggattgtg
gagctgtatgcccgcctttcacggactttcgcttaa

DBGET integrated database retrieval system