KEGG   Bacillus halodurans: BH1425Help
Entry
BH1425            CDS       T00039                                 

Gene name
glk
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bha  Bacillus halodurans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH1425 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH1425 (glk)
   00052 Galactose metabolism
    BH1425 (glk)
   00500 Starch and sucrose metabolism
    BH1425 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BH1425 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BH1425 (glk)
   00524 Butirosin and neomycin biosynthesis
    BH1425 (glk)
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BH1425 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512180..1513172
Genome map
AA seq 330 aa AA seqDB search
MSDRWYVGVDVGGTTIKMAFLTTAGEIVDKWEIPTNKQDGGALITTNIADALDKRLSGHH
KSKSDLIGIGLGAPGFIEMDTGFIYHAVNIGWRDFPLKDKLEEETKLPVIVDNDANIAAL
GEMWKGAGDGAKNMLLITLGTGVGGGIVANGNILHGVNGMAGEIGHITVIPEGGAPCNCG
KTGCLETVASATGIARIATEGVTEHKESQLALDYDKHGVLTAKDVFSAADASDAFALSVV
DHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYALPRVADGAEFRI
ATLGNDAGVIGGGWLVKQQENSMEKGNETE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagatggtatgttggtgtggacgtcggtggaacaacgataaagatggcgttt
ctcacaactgcaggagagattgttgataagtgggaaattccgacaaacaaacaggacggc
ggtgcgctgattacaacaaatattgccgatgctcttgataaacgacttagcgggcatcat
aaatcgaagagcgatctaattggaatcggactcggggcccctggttttatcgagatggat
accggctttatttatcatgcggtaaatattggttggcgggattttccgttgaaggataaa
ttagaggaggagacaaaactccctgtcattgtcgacaatgatgccaacatcgcagcgtta
ggagaaatgtggaaaggtgctggtgatggggcgaaaaatatgctgctcattacacttgga
acaggtgttggtggtggaattgttgcgaatggaaacattttgcatggggtcaatgggatg
gctggtgagatcggtcatattacggtcattccggaagggggggctccttgtaattgtggg
aaaacaggatgtcttgaaacagtagcaagtgcaactggaattgcccgaattgcaactgaa
ggagtgaccgaacataaggagagtcagctcgccctagattatgacaagcatggggtcctt
acggcgaaagatgttttttctgcagcggatgcgagcgatgcttttgcattatcggtcgtt
gatcatattgcctattatttaggctttgccattgccaacttagcgaatgctttgaacccg
gaaaaaatcgtcatcggtggtggggtctctaaagcgggagatacgctgctaaagccgatt
aagcagcattttgaagcctatgccctacctcgtgtggcagatggagcggagtttcgcatt
gcgaccctcgggaatgatgccggggtcattggcggcggatggttagtcaagcaacaagag
aacagcatggaaaaggggaacgaaacggaatga

DBGET integrated database retrieval system