KEGG   Bacillus halodurans: BH1425Help
Entry
BH1425            CDS       T00039                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00052  Galactose metabolism
bha00500  Starch and sucrose metabolism
bha00520  Amino sugar and nucleotide sugar metabolism
bha00521  Streptomycin biosynthesis
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH1425 (glk)
   00052 Galactose metabolism
    BH1425 (glk)
   00500 Starch and sucrose metabolism
    BH1425 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BH1425 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BH1425 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BH1425 (glk)
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BH1425 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAB05144
UniProt: Q9KCZ4
Position
1512180..1513172
Genome map
AA seq 330 aa AA seqDB search
MSDRWYVGVDVGGTTIKMAFLTTAGEIVDKWEIPTNKQDGGALITTNIADALDKRLSGHH
KSKSDLIGIGLGAPGFIEMDTGFIYHAVNIGWRDFPLKDKLEEETKLPVIVDNDANIAAL
GEMWKGAGDGAKNMLLITLGTGVGGGIVANGNILHGVNGMAGEIGHITVIPEGGAPCNCG
KTGCLETVASATGIARIATEGVTEHKESQLALDYDKHGVLTAKDVFSAADASDAFALSVV
DHIAYYLGFAIANLANALNPEKIVIGGGVSKAGDTLLKPIKQHFEAYALPRVADGAEFRI
ATLGNDAGVIGGGWLVKQQENSMEKGNETE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagatggtatgttggtgtggacgtcggtggaacaacgataaagatggcgttt
ctcacaactgcaggagagattgttgataagtgggaaattccgacaaacaaacaggacggc
ggtgcgctgattacaacaaatattgccgatgctcttgataaacgacttagcgggcatcat
aaatcgaagagcgatctaattggaatcggactcggggcccctggttttatcgagatggat
accggctttatttatcatgcggtaaatattggttggcgggattttccgttgaaggataaa
ttagaggaggagacaaaactccctgtcattgtcgacaatgatgccaacatcgcagcgtta
ggagaaatgtggaaaggtgctggtgatggggcgaaaaatatgctgctcattacacttgga
acaggtgttggtggtggaattgttgcgaatggaaacattttgcatggggtcaatgggatg
gctggtgagatcggtcatattacggtcattccggaagggggggctccttgtaattgtggg
aaaacaggatgtcttgaaacagtagcaagtgcaactggaattgcccgaattgcaactgaa
ggagtgaccgaacataaggagagtcagctcgccctagattatgacaagcatggggtcctt
acggcgaaagatgttttttctgcagcggatgcgagcgatgcttttgcattatcggtcgtt
gatcatattgcctattatttaggctttgccattgccaacttagcgaatgctttgaacccg
gaaaaaatcgtcatcggtggtggggtctctaaagcgggagatacgctgctaaagccgatt
aagcagcattttgaagcctatgccctacctcgtgtggcagatggagcggagtttcgcatt
gcgaccctcgggaatgatgccggggtcattggcggcggatggttagtcaagcaacaagag
aacagcatggaaaaggggaacgaaacggaatga

DBGET integrated database retrieval system