KEGG   Bacillus halodurans: BH1495Help
Entry
BH1495            CDS       T00039                                 

Definition
methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bha  Bacillus halodurans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BH1495
Enzymes [BR:bha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BH1495
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BH1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1572145..1573602
Genome map
AA seq 485 aa AA seqDB search
MNKQGKVYLVGAGPGDLRLMTLKGKDCLQKADVVLYDRLVNPLFLEWTKPEAELIYCGKL
PDRHLLRQEAINELLIEKGRQGKVVVRLKGGDPSVFGRVGEEADVLKEAGLPYEIVPGIT
AGIGASTYAGVPVTHRDYGASFTVVTGHDKSPSGQPLIDWHALANGIDTIAFYMGVSNLP
YITEQLIAHGRDPETCVLLIQWGTIGKQRVVEGRLNTIVSRVKEEGITNPAITLVGNIGK
LRTEKSWFESQRLFGHQVLIGRTTAEEGGLAKTLMEAGAEVFEFPRWHVTSKPWEVTPGE
VQEADHLVFTSPHSVHFFFESLTEQRMDIRHIRGSFFAASKKSLKIIRSFACTAALLQEL
PAGGKTIIFGDEENEMKQKYPFEEASYVSTHQKTLVPQSLRTCRRLLDEGRIETLVFPSA
ASVNAVIDGLEKCGESVGTLSQVKTVITFGPESSNAAKEAGFQVDIQLEAPSAQLLIETL
EAVRV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacaaggaaaagtttacttagtaggagcgggacctggtgatcttcgccttatg
acattaaaaggaaaagattgtttacaaaaggccgatgtcgtactgtatgaccgtttagtg
aatccgctctttttagagtggacaaaacccgaagcggaattgatctattgcggaaaactg
ccagaccgccatttgcttaggcaggaagcgattaatgaactgttaattgaaaagggacgc
caaggaaaagtcgtcgttcgcttaaaagggggagacccgagcgtattcggacgagttgga
gaggaagcagatgtgttaaaagaagcaggtttgccgtatgagatcgttcctgggataacc
gcaggaattggcgcttctacctatgctggagttcccgtgactcatcgggattatggggct
tcctttacggttgtaaccggccacgataaatcgccatctggacaaccgctcatcgattgg
catgcattagctaacggtattgatacgatcgctttttacatgggggtaagcaaccttccg
tacatcacggaacagcttatcgcccacggaagggatccagaaacgtgtgttctattaatc
caatggggaacgatcgggaagcaacgtgtcgtcgaaggacgtttaaatacaattgtttca
agggtaaaggaggaaggtatcacaaacccggccattactctagtcggtaatatcggaaaa
ttacgaacagagaaaagctggtttgagtcgcagcgtctttttggccatcaagtgttgatc
gggaggacgactgcggaggaaggtgggctagcgaaaacacttatggaggcaggagccgaa
gtgttcgaatttccacgttggcatgtaacatcgaaaccatgggaagtaacccctggtgaa
gtgcaagaggcggatcacctcgttttcacttcaccccatagtgtccactttttctttgaa
agcttaactgaacaaaggatggacattcgacacattcgcggctccttttttgcagcctca
aaaaaatcgcttaaaatcattcgttcatttgcctgtaccgcggccctcttgcaagagttg
cctgctggagggaaaacgatcattttcggtgatgaagaaaatgaaatgaagcaaaaatac
ccgttcgaagaggcaagctatgtctcgacacatcaaaaaacattggtccctcaatcgctt
cgaacctgtaggcggttgcttgatgaaggaagaattgaaacgcttgtgtttccgagtgcc
gcttctgtcaatgccgtaatagacggactagagaaatgcggggaatccgtagggacgtta
tcgcaagttaaaacggttattacgttcggacctgagtcctcaaatgcggcgaaagaagca
ggatttcaagtggacattcaattagaagctccttctgctcaattgttaattgaaacgttg
gaagcagtaagagtatag

DBGET integrated database retrieval system