KEGG   Bacillus halodurans: BH1661Help
Entry
BH1661            CDS       T00039                                 

Gene name
trpC
Definition
(GenBank) indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bha  Bacillus halodurans
Pathway
bha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01130  Biosynthesis of antibiotics
bha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BH1661 (trpC)
Enzymes [BR:bha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BH1661 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Crinivirus_P26
Motif
Other DBs
NCBI-ProteinID: BAB05380
UniProt: Q9KCB2
Position
1735658..1736431
Genome map
AA seq 257 aa AA seqDB search
MLDTILQTKREEIERLALPEQVEVKKVSLYDALRKPNRSLGLLAEVKKASPSKGLIRADF
HPVEIGKSYEAAGADAISVLTDETYFQGHRDYLTKVKQAVNIPVLRKDFIIDRAQILESV
RIGADAILLIVSTIPTTRLKELYDEAHELGLECLVEVHSEEEIAELFSAFTPTLIGVNNR
NLKTFETDVAQTEKMAQVIPHGTMFLSESGLYTYDDLQRVKRAGATGVLVGESLMRASSP
EEGIQHLFGGEPVATDA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatactattttgcaaacgaaacgagaggagatcgagcgtttagcattaccagaa
caggttgaagtgaagaaggtatcattatatgatgctttgcgcaaaccgaatcgatcgctc
ggtttacttgcagaggtaaaaaaagcctccccatcaaaagggctcattcgtgccgatttt
catcctgttgagatcggcaagagctacgaggctgctggtgcggacgctatttccgtgtta
acagatgaaacgtatttccaagggcatcgtgactatttgacaaaggtgaagcaagcggta
aacattcctgtgttgcgtaaagattttattatcgatcgggcgcagattttagagtcggtt
cgaatcggagccgatgcgattctattaattgtcagcaccattcctacgacacggttaaaa
gaactgtacgatgaagcccatgagcttgggctagaatgcttagtggaagtccatagcgag
gaggaaatcgctgagctattctccgcctttacaccaacactgatcggcgtcaataatcgt
aatttaaaaacgtttgaaaccgatgtggcccaaacggaaaaaatggcccaagttatccct
catggaacgatgtttttaagtgaaagtgggctttatacgtatgacgatttgcaacgggtc
aagcgagcaggagccacgggtgtactagtaggtgaatcgctcatgcgggcttcttcacca
gaagaagggattcagcatttgtttggaggcgaaccagttgcaaccgatgcttaa

DBGET integrated database retrieval system