KEGG   Bacillus halodurans: BH1663Help
Entry
BH1663            CDS       T00039                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bha  Bacillus halodurans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BH1663 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH1663 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BH1663 (trpB)
Enzymes [BR:bha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BH1663 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1737049..1738248
Genome map
AA seq 399 aa AA seqDB search
MTVTYPDERGRFGTFGGKYVPETLMSAIEELELALNDAMNDEAFIHDYKEHLREYAGRPT
ALTYAKNMSETLGGAKIYLKREDLLHTGAHKLNNAMGQALLAKRMGKKKIVAETGAGQHG
VATATIAARFGLECKVFMGEEDMERQALNVFRMELLGAEVVPATSGSKTLKDATNEAIRY
WVTHADDTFYLIGSVVGPHPYPQMVRDFQRIIGDEARAQFQEITGTLPTEVIACVGGGSN
AIGTFYPFLEDDVKLIGVEAAGKGVETSQHAATITKGRVGVIHGSMTYLLQDDAGQITEP
YSISAGLDYPGVGPEHAYLASTGRVKYDAVTDKEALDALKQLSVHEGIIPAVESAHALAK
AFERAKQLSQEESILVCLSGRGDKDVHTLMKHFRGEGHE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacatatccagatgagcgcggacggttcggcacgtttggtggtaaatacgtg
ccagaaacattaatgagcgcgattgaagaattggaattagcgttaaacgatgcgatgaac
gatgaagcgtttattcacgactacaaagaacacctgcgggaatatgcaggtaggccaacg
gcgcttacgtatgcaaaaaatatgtccgaaacgcttggcggcgcaaagatttatttgaag
cgagaggaccttctccacacgggggctcacaagctcaataatgcgatggggcaagcgctt
ttggccaagcgaatgggcaagaaaaaaattgtcgccgaaacaggcgcaggtcagcacgga
gtcgcaacggcaacgattgccgctcgcttcggtttagagtgcaaagtgttcatgggggaa
gaggacatggaacggcaagcgctgaatgtttttcgcatggagctactaggagcggaggtc
gttcctgctacgtccggcagcaaaacgcttaaagatgcaaccaatgaagcgattcgctat
tgggtgacccatgcagatgacaccttttatttaatcggttccgttgtcggtccccaccca
tatccacagatggttcgtgactttcaacggattattggcgatgaagctagggctcagttc
caggaaataactggaacgttgccgacagaggtgatcgcatgtgttggtggtggcagtaat
gcgataggaacgttttacccatttttagaggatgacgtgaagcttatcggcgtggaagcg
gcgggcaaaggagtcgagacttctcaacatgcggcgacgattacgaaaggacgagtaggt
gtcattcacggatcgatgacctacttgcttcaggatgacgctgggcaaattaccgagccg
tattcgatttcggctgggcttgactatccaggggtcggacctgagcatgcctatttagcc
agtactggtagagtcaagtatgacgcagtgaccgataaagaggcgctcgacgcgttaaag
caattgtcagtccatgaggggatcattcctgctgttgagtcggcacatgctctagcgaaa
gcatttgagcgggccaaacagctttcacaagaggaatccattctcgtttgtctttcaggg
cgcggagataaggacgtgcatacattaatgaaacattttcgaggtgaggggcatgagtag

DBGET integrated database retrieval system