KEGG   Bacillus halodurans: BH1664Help
Entry
BH1664            CDS       T00039                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bha  Bacillus halodurans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BH1664 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH1664 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BH1664 (trpA)
Enzymes [BR:bha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BH1664 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1738241..1739038
Genome map
AA seq 265 aa AA seqDB search
MSRLEAAVNGKKNLFIPFITAGDPNPEVTIELALTLEEAGADILELGIPYSDPLADGPVI
QAASKRALKHEMTLEKALSLVPKMRAQGLTIPVIVFTYVNPLLQYGEEQFVKRAADYQVD
GILVPDMPFEEGEVLQAACQEHNLSLISLVAPTSNKRIEKIAARAQGFVYCVSSLGVTGL
RDELDPRVHEFLQTVKTHASVPVVVGFGISRREQVEALAENADGVVVGSAIVKLVGELED
ELNDPEKLEDGLFKIKRFVSELISS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggttagaggcggcagtcaacggcaaaaagaatttattcattccatttattaca
gccggtgaccctaatccagaagtgacgattgagttagctctcacacttgaggaagcagga
gctgacatattggaacttggcatcccatattcggatccattggcggatggtccagtcatt
caggctgcctcaaagcgggcattaaaacatgaaatgacattagaaaaagctctttccctc
gttccgaaaatgagagcgcaagggttaaccattcctgtgattgtcttcacgtacgtgaac
ccactgcttcaatacggtgaagaacaatttgtgaaacgggcggctgactatcaagtggac
ggtattctcgttccggatatgccatttgaagaaggggaggtcttgcaagcagcgtgtcaa
gagcataacctgtccctcatttccctcgtggcgccaacatcgaacaaacggattgaaaaa
atcgccgcgcgagcacaaggtttcgtctattgcgtctcctcgttaggagtgaccggactc
cgggatgagcttgatcctcgcgttcacgagtttttacaaacggtaaagacgcacgcctcc
gtaccggttgtcgttggctttggtatctcaagacgcgagcaagtggaagcattggcggaa
aatgccgacggtgtcgtcgtggggagcgcgatcgttaagctagttggtgagctagaagac
gaacttaacgatccagaaaaactggaagatggactgtttaaaataaaaaggtttgtttct
gagctcatttcatcgtaa

DBGET integrated database retrieval system