KEGG   Bacillus halodurans: BH2133Help
Entry
BH2133            CDS       T00039                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bha  Bacillus halodurans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH2133
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BH2133
   00630 Glyoxylate and dicarboxylate metabolism
    BH2133
Enzymes [BR:bha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BH2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2258094..2260277)
Genome map
AA seq 727 aa AA seqDB search
METYEHVGNLQVATKLITFIEQRALPGTGIKKDDFWSGVQQIITELMPENKMLLAKREEI
QATIDAWHQKNKGPIDFSAYHSFLEEIGYLEPIPEHVTITTENVDDEIAAQAGPQLVVPV
NNARYAINAANARWGSLYDALYGSNVISEEDGCEKTGTYNPKRGTKVIQFAKDFLDHTFP
LTSGSHHEAINYAIMDKQLVVTLESGKMTRLKDETQFVGYQGSQGDPSVILLLHHGLHVE
IQIDARHPIGKSDRAKVKDIVLESALTTIMDCEDSVAAVDAEDKVAVYQNWLGLMKGTLE
ATFTKEGKTKKRKLNEDRSYTAPNGETFSLPGRSLMFVRNVGHLMTTPVIRTQSGEEVPE
GILDGIVTSLIAKHDLLQNGTFRNSKKGSVYIVKPKMHGSEEVAFANRLFNRIEDILGLE
RHTLKIGVMDEERRTSLNLKACIEKVKERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDM
KSSSWLSAYERSNVAAGLTCGFQGRAQIGKGMWAMPDLMNEMMEQKGTQLEAGANTAWVP
SPTAATLHAIHYHRHHVPAIQKTLADDQTCYRKEILEIPLAGSTDWTNEDIQAELNNNAQ
GILGYVVRWVEQGIGCSKVPDIHNTALMEDRATLRISSQHMANWLRHGIVSKEQVIRTME
RMAKVVDEQNAGDPAYRPMADNLEQSVAFQAALELVLKGTEQPSGYTEPILHRRRLEFKQ
KIAKELV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatacgaacatgtgggaaatttgcaggtggcgaccaaactaataacatttatt
gagcagagggctcttcctggaacggggattaagaaggacgatttttggtctggtgtccag
caaatcatcactgaattgatgccagaaaacaagatgcttctcgctaaacgtgaagaaatt
caagcaacgatcgatgcgtggcatcaaaaaaataaaggacccattgatttttcagcgtat
cactcgtttttagaagaaatcggctatttagagccaatccctgaacatgtaaccattaca
acggaaaatgtggatgatgaaatcgcggcgcaagcaggaccacagctagtggttccagtc
aacaatgcacgatatgcgattaatgcagcgaatgctcgctggggaagtttgtatgatgcc
ctttacggatcgaatgtcatttcagaagaggacggatgcgaaaaaacggggacatacaac
ccgaaacgaggaaccaaagttattcagtttgccaaagacttcttagatcatacgttcccg
cttacaagcggctctcatcatgaggctatcaactatgccatcatggataagcaactagtc
gttacacttgaatctggaaagatgacacgattaaaggacgagacacagtttgtcggttac
caaggttcacaaggagacccatctgtcattcttcttcttcatcatggacttcacgtagaa
attcaaatcgatgcaagacacccaattggaaaaagtgatcgggcaaaggtgaaggacatt
gtccttgagtccgcgctaaccacaattatggattgtgaagattccgtcgcagctgttgat
gctgaagacaaagtagctgtctatcaaaactggcttggtcttatgaaaggaacacttgaa
gcaacgtttacgaaagaaggaaaaacaaaaaagcgaaagttaaacgaggatcgaagctac
acggcacctaatggagaaacgttctcgctaccagggcgttcgctcatgtttgtccggaat
gttggacacttaatgaccacgcctgttattcgaacgcaatcaggcgaggaagtgccagaa
ggcattctagatggaatcgtcacgagcctaattgctaagcatgatttgttgcaaaatggc
acattccgaaactcaaaaaaaggatcggtttacatcgtaaagccaaaaatgcatggttcg
gaggaagtggcttttgccaatcgattgtttaatcgaattgaagacattctcggtttggaa
cgtcatacgttgaaaatcggcgtcatggatgaagagcggcgcacgtccctaaatttaaaa
gcatgcattgagaaagtaaaggaacgggtcgtctttatcaatacgggatttttggatcga
actggggatgagattcatacatcgatggaagcgggcccgatgattcgcaaaggggatatg
aagtcgtctagctggctctcagcctatgagcgatccaatgtagccgcgggcctaacttgt
ggtttccaaggccgagctcaaatcggaaaaggaatgtgggcaatgccggatcttatgaac
gagatgatggaacagaaaggaactcaacttgaagctggagcaaatacagcatgggtgcca
tcgccaacagcagcgacgcttcacgccattcattatcatcgccaccatgtacctgccatt
caaaagacacttgcagatgatcaaacgtgctatcgcaaggagattcttgaaatccctcta
gctggctctaccgactggacgaatgaggacattcaagcagagcttaataataatgcccaa
gggattctcggttatgtcgtccgttgggtggaacaagggatcggttgctctaaggtgcct
gatattcacaacacagcattaatggaagatcgtgccactttgcgcatttcgagtcaacat
atggccaattggcttcgtcacggcatcgtaagtaaggagcaagtgattcgtacgatggaa
cgcatggcaaaagtagtggatgaacaaaatgccggggatcccgcctaccgtccaatggct
gataatcttgagcagtctgtcgccttccaagcagcattagagctcgtgttaaaaggtaca
gaacaaccgagtggttatacagagccgatcttgcatcgtcggcgcctagagtttaaacaa
aaaatcgcaaaagaactcgtgtaa

DBGET integrated database retrieval system