KEGG   Bacillus halodurans: BH2205Help
Entry
BH2205            CDS       T00039                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bha  Bacillus halodurans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH2205
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BH2205
  Amino acid metabolism
   00310 Lysine degradation
    BH2205
Enzymes [BR:bha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BH2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2326062..2327297)
Genome map
AA seq 411 aa AA seqDB search
MIEIKVPELAESITEGTIAQWLKKVGDHVSQGEYIAELETDKVNVEITAEHSGVIQELKR
EEGDTVEVGEVIAVLAEGDSPTASTEQAEAPKEEKKVSTVASEEAAPAPGNRPVASPAAR
KLAREKGIDLEAVPTADPLGRLRKQDVASYEEKPAASAPAKAPEKKAAPAAANVESPGKP
VERIKMSRRRQTIAKRLVEAQQTAAMLTTFNEVDMSAVMELRKRRKDQFFEKHDVKLGFM
SFFTKAVIGALKEFPLLNAEIQGDEILLKKYYDIGIAVSTDEGLVVPVVRDADRLGFAGI
EREIMHLGKKARENKLSLSELQGGTFTITNGGVFGSLWSTPILNAPQVGILGMHKIQWRP
VAIDEENFENRPMMYIALSYDHRIVDGKEAVSFLVRVKEMLEDPESLLLDS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaaattaaagtaccggaactagcagaatcgattacagaaggaaccatcgcgcaa
tggttgaaaaaggttggggaccacgtatcccaaggggaatacattgcagagcttgaaaca
gataaagtcaatgtagaaattacggcagagcactcgggtgtcattcaagaactaaaaaga
gaagaaggtgacacagtcgaggtaggagaagtgatcgccgttctagcggaaggcgactct
cctactgcttcaaccgaacaagcagaggctccgaaagaagagaagaaggtttctactgta
gcttctgaggaagcagcccctgcccctgggaatcgtccggtcgcgtcaccggcggcacga
aagcttgcgcgggagaaagggattgatttagaagctgtgccaacagctgacccgttagga
cgtttgcgcaagcaggatgtggcttcatatgaagaaaaaccagcagcttctgctccggcg
aaggcacctgagaaaaaagcggctcctgccgcagctaacgttgaatcaccaggaaagcca
gtggagcgaatcaaaatgtcccgtcgccgtcaaacgatcgccaagcgtcttgtagaagca
cagcaaacagcagctatgctcacaacgtttaatgaggtagatatgtcggcggtaatggaa
cttagaaagcgccgcaaagaccaattttttgagaagcatgatgtgaagctcggattcatg
tctttctttacaaaagcagttatcggcgcattaaaagagttcccgcttcttaacgctgag
atccaaggagatgaaatcttactgaaaaaatattatgacatcggcatcgccgtatcgaca
gacgagggccttgttgttcctgttgtccgcgatgcagatcgcctcggtttcgcaggcata
gaaagagaaatcatgcaccttggaaagaaagcacgtgagaataagctctccctttcagaa
ttgcaaggaggaacgtttacgatcactaatggcggcgtgtttggctctctttggtcaaca
ccgattttaaatgcgcctcaagtggggatcttaggaatgcataaaattcaatggcgccct
gtggcaattgacgaagaaaactttgaaaatcgcccgatgatgtacattgccctttcttac
gatcatcgaattgtagatgggaaagaagcggtaagcttcctcgtacgagtcaaagaaatg
ctagaagatccagaatcgctgctcttagatagttaa

DBGET integrated database retrieval system