KEGG   Bacillus halodurans: BH2228Help
Entry
BH2228            CDS       T00039                                 

Gene name
melA
Definition
melibiase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bha  Bacillus halodurans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bha00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bha00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bha00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2354522..2355826)
Genome map
AA seq 434 aa AA seqDB search
MGKITFLGAGSTIFAKNVLGDCMLTPSLQEFEFALFDIDLDRLHDSETMLKHLKETLQAN
VKIEAYTDRKEALRGAKYVVNAIQVGGYDPCTITDFEIPKKYGLRQTIADTVGIGGIFRS
LRTIPVMLDFATDMEEVCPDAWLLNYTNPMATLTGTMLRYTGVKTVGLCHSVQVCAPELL
DRLGMEKDNIQWKIAGINHMAWLLEITREGEDLYPEIKRRAKEKQQNERHDDMVRFELMF
RFGYYVTESSEHNAEYFPYFIKEKYPELIERLNIPLDEYPRRCINQIEDWKKMRKDLVNN
KHITHERTHEYASYIMEAMETNKPFQIGGNVLNKGRLIANLPENACVEVPCLVDRNGIQP
TYVGELPEQLAALNRTNINTQLLTIEAAMKRKKEAIYQAAMLDPHTSSELSIDDIVSLCD
DLIEAHGSWLQSFK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagattacatttcttggagcaggaagtacgatatttgcgaaaaacgtactcggt
gactgcatgctgacaccgagcttacaagaatttgagtttgcgctatttgacattgacctt
gatcgtttacatgattctgaaacgatgctgaagcatttaaaagaaacattgcaagcaaat
gttaaaatcgaagcgtacacagatcgaaaagaagcgttgcgcggggctaaatacgtcgtc
aacgccatacaggtcggcggctatgatccgtgtacgataactgattttgaaataccgaaa
aaatacgggttacgccaaacgatcgcagataccgtcgggatcggggggattttccgcagc
ttgcgaacgattccagtcatgctcgattttgctactgacatggaggaggtatgtccggat
gcatggctgctgaattacacaaatcctatggccacattgacagggactatgctgcggtat
acgggagtaaaaacggtaggcttgtgtcacagtgtgcaagtatgtgcacctgaactcctc
gatcgcctcgggatggaaaaggacaatattcagtggaaaattgcaggaattaatcatatg
gcatggctcttggaaattacaagggaaggggaagacctataccctgaaatcaaacgtaga
gcaaaggaaaaacaacaaaatgaacggcatgatgacatggttcgctttgagttaatgttt
cgtttcggctactatgttacggaatcctctgagcataatgcagagtatttcccatacttt
attaaggaaaaatatccggagcttattgaacgtctaaacattccccttgatgaatatcca
cggcggtgcatcaatcaaatcgaagattggaaaaagatgcgtaaagatttagtaaacaac
aagcatattacccatgaacggactcatgaatatgcctcctatataatggaggcgatggag
acgaataagccgtttcaaattggcggtaacgtcttaaacaaaggtagattaatcgccaat
ttgccggagaacgcctgtgtcgaggtgccgtgtctcgtcgatcgaaatggcattcaacca
acgtatgtgggcgaacttccagagcaactagccgcgctaaatcgaacaaacatcaatacc
caactgctgacaattgaagcggcgatgaaacggaaaaaagaggcgatttatcaggcagct
atgttagatcctcatacgtctagtgaactttcgatcgatgatattgtttccttatgtgat
gatttaatagaagcccatggaagctggctacagtccttcaaataa

DBGET integrated database retrieval system