KEGG   Bacillus halodurans: BH2466Help
Entry
BH2466            CDS       T00039                                 

Gene name
gid
Definition
tRNA (uracil-5-)-methyltransferase Gid
Orthology
K04094  
methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
bha  Bacillus halodurans
Brite
Enzymes [BR:bha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     BH2466 (gid)
Transfer RNA biogenesis [BR:bha03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    BH2466 (gid)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2583641..2584948)
Genome map
AA seq 435 aa AA seqDB search
MSTPHINVIGAGLAGSEAAWQIAERGIAVHLYEMRPVKQTPAHHTDKFAELVCSNSLRGN
SLTNAVGVLKEEMRRLNSVIIRSADRCSVPAGGALAVDRHEFAQAVTEAVREHPNVTVFT
EEIQKIPDGPTVIATGPLTSKALSEQLKQLTGEEYLYFYDAAAPIIETDSINMDKVYLKS
RYDKGEAAYLNCPMTEEEFDRFYEALISAETVPLKEFEKEVFFEGCMPVEVMAKRGKKTL
LFGPMKPVGLEDPKTGKRPYAVVQLRRDNQSGTLYNIVGFQTHLKWGPQKEVIQLIPGLE
NAEIVRYGVMHRNTFINSPNLLKPTYQYKKRKDLFFAGQITGVEGYVESAAAGLVAGLNA
ARLVQSKELVVFPDTTMLGSMANYITTANSKNFQPMNANFGLLPPLDTRIKDKKTRYETL
AGRALESIQNFVKKM
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgccacatattaatgttatcggagcagggttggctggaagtgaagctgcatgg
caaatcgctgagcggggaatcgcagtccacctatacgagatgcgtccagtgaagcaaaca
cctgcccatcatacggataaatttgcagagcttgtctgcagcaattcgctgcgtggaaat
agtttgacgaatgcagttggtgtgttgaaagaagagatgcggcgtttgaattcggttatt
atccgttcagctgaccgttgctcggttccagcagggggagctctagctgtggatcgtcat
gaatttgcgcaagcggttaccgaagcggtacgagagcacccgaatgtaacggtttttacc
gaggaaattcaaaagatccctgatggaccaacggtcatagcgacaggcccgttaacgtca
aaagcattatccgagcagctaaaacaattaaccggtgaagaatacttatacttttacgac
gcagccgctcctataattgaaaccgattcaattaatatggacaaagtctacctcaagtcg
cgttatgataaaggagaagcagcctatttaaattgtccgatgacagaggaggagtttgat
cggttttatgaggctctcatctctgcagagacggttcctttaaaagagttcgaaaaggaa
gttttctttgaaggctgtatgcctgttgaagttatggccaaacgagggaaaaagacgctt
ctattcggaccgatgaaaccagttggcttagaggacccaaaaacaggtaagcgcccgtac
gcagtcgtgcaattacgacgagacaaccagtcggggacactgtataatattgtcggcttt
caaacccatttaaagtggggaccacaaaaagaagtgattcaattaattccagggttagaa
aacgcagagatcgtccgctacggtgtcatgcatcgcaatacgtttattaattcacctaac
ttattaaagccaacctatcaatacaagaagcggaaagatcttttctttgctggacagatt
acaggggttgaagggtacgtggaatccgcggcagccggtcttgtcgcaggcctcaatgcg
gcacggctcgtccaaagcaaagagcttgttgtattcccagatacgacgatgctaggaagc
atggcgaattacattacaacagccaattcgaaaaatttccagcctatgaatgccaacttt
ggcttactaccacctcttgatacccggatcaaggataaaaaaacacgctatgaaacgtta
gctgggcgggcactagaatcaattcagaattttgtgaaaaaaatgtaa

DBGET integrated database retrieval system