KEGG   Bacillus halodurans: BH2470Help
Entry
BH2470            CDS       T00039                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (beta subunit)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bha  Bacillus halodurans
Pathway
bha00020  Citrate cycle (TCA cycle)
bha00640  Propanoate metabolism
bha00660  C5-Branched dibasic acid metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BH2470 (sucC)
   00640 Propanoate metabolism
    BH2470 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BH2470 (sucC)
Enzymes [BR:bha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BH2470 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAB06189
UniProt: Q9KA20
Position
complement(2589207..2590367)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKELLRQYGVAVPNGKVAFSVDEAVEAAKELGSNVCVVKAQIHAGGRGKAGGV
KVAKNLDEVRTYADEILGKTLVTHQTGPEGKEVKRLLIEEGCDIQKEYYVGLVLDRATSR
VVMMASEEGGTEIEEVAEKTPEKIFKEIIDPVVGLQGFQARRLAFNINIPKELVGQAVKF
MLGLYKVFVEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRQKAILEFRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMATMDIIKHYNGEPANFLDVGGGATAEKVTE
AFKIILSDESVKGIFVNIFGGIMKCDVIAEGVIQATKEVGLSIPLVVRLEGTNVDLGKKK
LEESGLNITAADSMADGAQKIVSLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaagggaaagagctccttcgtcagtacggtgtagcggttccg
aacggaaaagttgccttttctgttgacgaagcggttgaagcagcaaaagagctcggctct
aatgtttgtgtggtaaaagcgcaaattcacgcagggggtcgaggaaaagcaggcggcgtc
aaggtggcgaaaaatcttgatgaggttcgtacatatgctgacgagattttaggaaaaacg
ttagttactcatcaaacaggtcctgaaggtaaagaagttaagcgcttacttatcgaagaa
gggtgcgacatccagaaagagtactatgttggccttgtcctcgacagagccacttctcgc
gttgtcatgatggcatctgaagaaggtggtactgaaatcgaggaagtggcagaaaaaaca
cctgaaaaaatctttaaagaaatcatcgatccagtggtcggcttacaaggcttccaagcg
cgcagattggcgttcaacatcaacattccgaaagagctcgttggacaagcagtgaagttc
atgctcggattgtacaaagtatttgttgaaaaagattgctctattgccgagatcaatccg
ctcgtcacaacaggtgatggaaaggtcatggcccttgatgcgaagctaaactttgattcg
aatgctctttatcgtcaaaaggctatcctcgaattccgtgatttagacgaagaggatcca
aaggaaatcgaagcgtcaaaatatgatttgagctacatttctttagatggaaatatcggc
tgcatggtaaacggtgcaggtttagccatggcaacaatggatattattaaacattacaac
ggtgaaccggcgaacttcctcgatgttggaggcggtgcgacggcagagaaagttacagaa
gcgttcaagatcattctttctgatgaaagtgttaaaggaatctttgttaacattttcggt
ggtatcatgaaatgtgatgtcatcgcagaaggggttattcaagcgacgaaggaagtagga
ttaagcatccctcttgtcgttcgccttgaaggaacaaacgttgatttaggtaagaaaaag
cttgaagagtctggattaaacattacagcagccgattcaatggcagacggtgcacaaaaa
attgtttctctcgtgaaatag

DBGET integrated database retrieval system