KEGG   Bacillus halodurans: BH2539Help
Entry
BH2539            CDS       T00039                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bha  Bacillus halodurans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BH2539 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BH2539 (pyrB)
Enzymes [BR:bha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BH2539 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2663436..2664353)
Genome map
AA seq 305 aa AA seqDB search
MAVPFLQDHDTKHDLLTMSHLSLEEIEHILHDAQQFENGALWSPEEKLFVANLFFEPSTR
TRVSFEVAEQRLGLHVVNVDGERSSVQKGETLYDTAKTLESIGVNALVIRHRQDRYFEEL
KDRINIPIINAGDGCGHHPTQSLLDLWTIQQEFGRFSNLITVISGDLRHSRVARSNAETL
TRLGARVYISGPREWMEGYEGVYPYVTMDEAVELADVIMLLRVQHERHDGTVSFTQASYH
EQFGLTVKREARMKPKSIVMHPAPVNRNVEIASELVECPRSRIFKQMKNGVAIRMAVLKR
ALTDE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaccgttcttacaggatcatgatacgaaacacgacttgcttactatgtcccat
ttatcgcttgaggaaattgagcacattttgcacgatgcccagcagtttgaaaatggtgcc
ctttggtcgccagaggaaaagctttttgtcgccaatttgttcttcgagccgagcacgcgg
acgagagtgagctttgaagtagccgagcaacgacttgggctccatgtcgtcaatgtggat
ggggaacgatccagcgtgcagaaaggggaaacgctgtacgatacggcgaaaacactcgag
tctatcggtgtaaacgccctcgtcattcgccatcgccaggaccgatatttcgaagaattg
aaagatcgcatcaacatcccgatcattaatgctggcgatggttgtggccatcacccgacc
caatccttgctcgatttgtggacgatccaacaggaatttggtagattttctaaccttatc
actgttattagtggagaccttcgccatagccgagtagctcgctcgaatgccgaaacctta
actcgtctcggtgcccgcgtttacatttcaggtccgcgggaatggatggaaggctatgag
ggggtttacccttatgtgacgatggatgaagcggtcgaactagcggacgtcatcatgctc
ttgcgcgttcagcacgaacggcatgatgggaccgtttcattcacccaagcatcgtaccat
gagcaatttggcttaacggtcaaacgggaagcgcggatgaagccaaaaagcattgtcatg
cacccagcgcctgtgaatcgtaatgtggagattgcgagcgagcttgtggaatgcccacgc
tcacgaatctttaaacagatgaaaaacggggtcgccatccgaatggccgtgttaaagcga
gcattgacagatgaataa

DBGET integrated database retrieval system