KEGG   Bacillus halodurans: BH2653Help
Entry
BH2653            CDS       T00039                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00020  Citrate cycle (TCA cycle)
bha00620  Pyruvate metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Module
bha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH2653 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BH2653 (pdhC)
   00620 Pyruvate metabolism
    BH2653 (pdhC)
Enzymes [BR:bha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BH2653 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAB06372
UniProt: Q9K9J4
Position
complement(2774738..2776018)
Genome map
AA seq 426 aa AA seqDB search
MAYEFKLPDIGEGIHEGEIVKWFVKPGDEVKEDDILLEVQNDKAVVEIPSPVDGKILEVK
VEEGTVAIVGDVLVTIDAGEGVGAEETEEAPAPEEKAEEAAPAEPAPAKETAPEEDGDED
KRVIAMPSVRKYAREKGVNIKKVKGTGKNGRILREDIDAFLSGDTQAEASEEKAETAAPA
AASNVEPTEIPVGEREERVPLKGIRKAIAKAMVNSKHTAPHVTHMDEVDVTALVAHRKQY
KEIAAEQGTKLTYLPYVVKALTSALKKYPVLNASIDDVNEEIVYKHYFNIGIAADTEQGL
VVPVIKDTDRKSIFELADNINELAIKARDGKLSAAEMKGGSCTISNLGSARGQWFTPIIN
HPEVAILGIGRIEEKPVVKDGEIVAAPVLALSISYDHRLIDGVTAQNALNHVKRLLNDPQ
LMLMEG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttggcttacgaatttaaattgcctgacatcggggaaggcattcatgaaggtgagattgtc
aaatggttcgtgaaacctggtgatgaagtaaaagaagacgatattcttttggaagttcaa
aacgataaagcagtcgtagaaattccttcaccggttgacgggaaaattttagaggttaaa
gtagaagaagggacagtagcgattgtcggtgatgtgctcgtcacgatcgatgctggagaa
ggagtaggagcggaagaaacagaagaagcccctgcaccagaagaaaaagctgaggaagca
gcaccagctgagccggcaccagcaaaagaaacagcacctgaagaagacggcgacgaagac
aaacgcgtcatcgcgatgccatctgttcgtaaatacgctcgtgaaaaaggtgtaaacatt
aagaaagtgaagggaacagggaaaaacggtcgcattttacgtgaagacattgatgctttc
ttgagtggagatactcaagcagaggcttcggaagaaaaagccgaaacagcggcacctgcg
gcagcatctaatgtggagccgactgaaattcctgttggtgaacgggaagagcgcgtaccg
cttaaagggatccgtaaagcgatcgcaaaagcgatggtcaactcgaaacatacagccccg
catgtcacccacatggatgaagtggatgttacggctcttgttgcacatcgtaaacagtat
aaagaaatcgcagcagagcaagggacaaagctcacatacttaccttatgttgtgaaggct
ttaacgtctgcgttgaagaagtatccggttcttaatgcgtcgattgacgacgtgaacgag
gagattgtgtacaagcattacttcaatattggtattgcggctgacacagagcaaggactt
gtcgttccagtcattaaagacacagatcgtaaatcgatctttgaattagctgacaacatt
aatgagcttgcgattaaagcacgtgatggtaagttgagcgctgctgaaatgaagggcggc
tcttgcacaatctcaaaccttggttctgctcgtggtcaatggttcacgccaattatcaac
cacccagaagtagcgattttaggaattggccgaatcgaagagaagccagttgttaaagat
ggtgaaattgtagcggctccagttctcgcactttcaatcagctatgatcaccgcctcatc
gacggggtcacagcacaaaacgcactgaatcatgtgaagcgtttgttgaacgatccacaa
ttaatgttaatggaggggtaa

DBGET integrated database retrieval system