KEGG   Bacillus halodurans: BH2677Help
Entry
BH2677            CDS       T00039                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bha  Bacillus halodurans
Pathway
bha00630  Glyoxylate and dicarboxylate metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01200  Carbon metabolism
Module
bha_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BH2677
Enzymes [BR:bha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BH2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAB06396
UniProt: Q9K9H0
Position
complement(2797437..2798720)
Genome map
AA seq 427 aa AA seqDB search
MSGWQETAEKLEMSWSNDVRWQGVERPYSGEEVVKLRGSLKIEYTLAKTGAEKLWKLLHE
EDYVNALGAMTGGQAIQQVKAGLKAIYLSGWQVAADANLAGHMYPDQSLYPANSVPSVVK
RINQALQRADQIQHLEGEGEVDYFAPIVADAEAGFGGQLNVFELMKAMIEAGASGVHFED
QLASEKKCGHLGGKVLIPTQTAIRNLVSARLAADVMGVPTILVARTDADAADLITSDIDP
ADQRFITGERTPEGFYRTNAGIEQAIARGLAYAPYADLIWCETSKPSLEEAKQFADAIHE
KFPGKLLAYNCSPSFNWEANLDRATIETFQQELGKMGYKFQFVTLAGFHALNHSMFELAY
GYKQRGMGAYSELQQAEFASEVKGYTATRHQREVGTGYFDQVAQTITGGTSSTTALTGST
EEAQFQK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagtggatggcaagaaacagcggaaaaattagagatgtcttggagcaatgacgtgcgg
tggcaaggagtggagcgtccatatagcggagaggaggtagtcaaactacgaggctcgctt
aaaatcgagtatacccttgcaaagactggggcggaaaaactatggaagctactccacgaa
gaggattacgtgaatgccctcggtgcgatgactgggggacaggcgatccaacaagtaaag
gcgggtttgaaagcgatttatttaagtggatggcaagtagcagcagacgccaatctagca
ggacatatgtatccagaccaaagcttatatcctgccaatagcgttccaagtgtcgtaaag
cggatcaatcaagcacttcagcgagctgatcaaattcaacatcttgaaggggaaggagaa
gtggattatttcgcgccaatcgtagctgatgcggaagctggctttggtggtcaattaaac
gtctttgagctcatgaaagcgatgattgaagcaggagcttctggggttcactttgaggat
caactcgcttctgaaaagaagtgtggtcatttaggcggaaaagttctcatcccgacgcag
acggcaatccgcaatttagtatcggcaagactagcagctgatgttatgggagtgccgacg
attttggtcgcccggaccgatgcagatgcagctgatttaattacgagtgatattgatcca
gcagaccaacgttttattacgggagaacgaacgccggaagggttttatcggacgaatgca
ggcattgagcaagcgattgctagaggcttagcgtacgctccatatgcggacctcatttgg
tgtgaaacatcaaagccttcgttagaggaagcgaagcaatttgccgacgcgattcatgag
aaattccctggaaaactacttgcctacaattgttcgccttcatttaactgggaggcaaat
ctagatcgggcgacaatcgaaacatttcaacaagagctcggtaagatggggtataagttc
caatttgtcacgcttgcaggctttcatgcactgaaccatagcatgtttgagcttgcatat
ggctataaacaacgggggatgggcgcttattctgaacttcagcaagccgaatttgccagt
gaagtaaaaggttatactgcaacgagacatcaacgtgaagtgggaaccggttattttgat
caagtggcacaaacaatcacagggggaacatcatcaacgactgcacttactggttcgacc
gaggaagcgcaatttcaaaaataa

DBGET integrated database retrieval system