KEGG   Bacillus halodurans: BH2815Help
Entry
BH2815            CDS       T00039                                 

Definition
glycine dehydrogenase subunit 1 (EC:1.4.4.2)
Orthology
K00282  
glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
bha  Bacillus halodurans
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH2815
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH2815
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     BH2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2938735..2940078)
Genome map
AA seq 447 aa AA seqDB search
MNHRYLPMTTDDRQEMLQAIGVDSIEELFSDIPQDIRFKGKLNIPNALKEPELIRYFQQL
ANENVHLKDKASFLGAGVYDHYIPSIVDHVISRSEFYTAYTPYQPEISQGELQAIFEFQT
MICELTGMEVANSSMYDGPTALAEAAMMSCGHTKKKKILVSKAVHPEARDVLMTNAYGQR
LEVVEIDTNNGVTDVEHLKALYDEETACVIVQHPNFFGRLEPLAEIESVSHQGKATFVVS
SNPLALGLLKPPGAFGADVVVGDAQPFGIPTQYGGPHCGYFATTKKLMRKVPGRLVGQTT
DDQGQRGFVLTLQAREQHIRREKATSNICSNQALNALAAAVAMATIGKRGVKEMALQNVQ
KAAYAKSQLKANGVEIVAEGPCFNEFIIKLSSPLHEVEEALLAKGFIAGYDLGKVYPELE
GHMLVAVTEVRTKEEIDQFAKEVGMFA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcgttacttaccaatgacaacggacgatcgacaggaaatgctacaggcgatc
ggtgtcgactcaattgaggaactgttttcggatattccgcaagatattcgcttcaaaggg
aagctgaacattccgaacgcgttaaaagagccagaactcattcgttattttcagcagtta
gcgaatgaaaatgttcacttaaaagataaagcctcttttttaggtgctggagtgtatgac
cattacatcccatcaattgtcgaccatgtcatttcacgctctgaattttatactgcatat
accccttaccagccggaaatttcccaaggggagttacaagccatctttgaatttcaaacg
atgatttgtgaattaaccggaatggaagtggccaattcatccatgtatgacggaccgaca
gcattggcagaagcagcaatgatgagctgtggacatacgaaaaagaaaaaaattcttgtt
tccaaagctgtccatccagaggcgcgcgatgtattaatgacgaatgcttatggacaacgt
ttagaagtagttgagatcgacacgaacaatggtgtaacggatgtagagcatttaaaggcg
ttgtatgatgaggaaaccgcttgtgtgatcgtgcaacacccgaactttttcggccgactt
gaaccattagcggaaattgaatcagttagtcatcaagggaaggcgacgttcgtcgtttca
agtaatcctcttgcgcttgggttattgaagccaccaggggccttcggagctgatgtggtc
gttggagatgctcaaccgtttggaattccaacacaatatggcggccctcactgcggatat
tttgccactacgaaaaagttgatgagaaaagtacctggacggctcgttgggcaaacgacc
gatgatcagggacagcgaggcttcgtgcttactctacaagcgagagagcagcatattcgg
cgtgaaaaagcgacatctaatatttgttcgaaccaagcccttaatgccctagccgctgcg
gttgctatggccacaatcggtaaacgtggcgtcaaggaaatggccttacaaaacgtacaa
aaagcggcatacgctaaatcccagcttaaggccaatggtgtagaaatcgttgcagaagga
ccttgctttaatgaatttatcattaagttaagcagtccgcttcatgaagtggaggaagcg
ttgcttgccaaaggattcattgcagggtacgacctggggaaagtgtatccagagcttgag
ggacatatgctcgtcgctgtgacagaggtaaggacaaaagaggagatagatcaatttgca
aaagaagtggggatgttcgcatga

DBGET integrated database retrieval system