KEGG   Bacillus halodurans: BH3201Help
Entry
BH3201            CDS       T00039                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bha  Bacillus halodurans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH3201
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH3201
   00620 Pyruvate metabolism
    BH3201
   00640 Propanoate metabolism
    BH3201
  Energy metabolism
   00680 Methane metabolism
    BH3201
Enzymes [BR:bha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BH3201
Lipid biosynthesis proteins [BR:bha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BH3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3317501..3319084)
Genome map
AA seq 527 aa AA seqDB search
MKVEHMAPEEYNLTEELDVFARDVNRLAIRFLDDKGHRKDISYAELMNTVHQYANALTKC
GLKRGDKVLVVVPRIPEAYYCYLACLKAGIVIIPCSNMLRANDFVYRIQHSEAKAIIAHV
QATDEIDSMSVPLPSLQYKWVISGTKSGWESLEDVARNESVSFEGVKTRRDEMAFLPYTS
GTTGNPKGVVHTHGWAYAHLQTAAKHWLGVREGDLVWATAAPGWQKWVWSPFLSTIGLGA
TAFVYNGPFDPNEYLALLEKEDINVLCCTPTEYRFMAKVDNLNRYRFPHLHSAVSAGEPL
NRKVIEMFRDTFGINVRDGYGQTENTLLVGTMIGMEQRPGSMGKPTLEGQVVIVNEDGQP
VAPHEVGEIAVHKDAAALFKEYYREPERTAQAFRGDYYITGDLARMDEDGFFWFEGRSDD
IIISSGYTIGPFEVEDALTKHPAVKECAVVASPDEDRGAVVKAYIVLKDSTNLDEEALSK
ELQDHVKAHTAPYKYPRKVEFVESLPKTISGKIRRIELRQQEQLRAQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggaacacatggcaccggaagaatacaatctgacggaggaacttgacgtattt
gcaagggacgtaaaccgactcgccattcgatttttagatgataagggtcatcggaaagac
atttcgtatgccgagttaatgaataccgttcatcaatatgcgaatgcgttaaccaagtgc
ggacttaagcggggagacaaagtgcttgtggtggtaccaagaattccagaagcgtattat
tgctatttagcctgtttaaaggcgggaattgttattattccttgttccaacatgcttcgg
gccaacgattttgtttatcgaattcaacattcagaagcaaaagccatcatcgcccatgtt
caagcaaccgatgaaattgacagcatgagtgttcctcttccttcactacagtataaatgg
gttatttcaggcacaaaatcaggatgggaatcgctagaagatgttgcaaggaatgaaagc
gtttcctttgagggtgtgaaaacaagacgggacgaaatggcgtttttgccttacacctcg
ggaacaacaggtaatccaaaaggggttgtccatacccacggttgggcttatgctcatttg
caaacagcagcgaaacattggcttggcgtccgtgaaggagatctcgtctgggcaacggct
gctcctggatggcaaaaatgggtatggagcccgtttttatcaacgatcggtctaggggcg
accgcgtttgtctacaatggtccttttgatccgaacgagtatttagccttgttagagaaa
gaagacatcaatgttctatgctgtacgccaacagaatatcgttttatggcgaaagtagac
aatctcaatcgctaccgttttccccatttgcacagcgcggtgtccgcgggagagccgctg
aatcgaaaggtcattgagatgttccgagacacgtttgggatcaacgtaagggacggttat
gggcagaccgagaacacgcttttagtcgggacgatgattggcatggaacagcgaccagga
tcgatggggaagccaacacttgaagggcaagtcgtcatcgtgaatgaggatggtcagcct
gtggcccctcacgaagtcggagagattgccgtacataaggatgcggctgctttattcaag
gaatattatcgggagcctgagcggaccgctcaagcgtttcgtggagactactacattaca
ggggatctagcaagaatggatgaggatggctttttctggtttgaggggcgcagtgacgat
attattattagttcaggttatacgatcggaccgtttgaagtagaggatgctttgacgaaa
catccagcggtaaaggaatgtgcggttgtcgcgagtcccgatgaagatcgcggagccgtt
gtgaaagcgtatatcgttctgaaagattccacgaatctagatgaggaagcgctcagcaaa
gagttgcaagatcatgtgaaagcgcacaccgctccatacaaatacccaagaaaagtggag
tttgtcgagtcgctaccgaagactatttccggaaaaattaggcgtatcgaattaagacaa
caagagcaattgcgggcacagtaa

DBGET integrated database retrieval system