KEGG   Bacillus halodurans: BH3201Help
Entry
BH3201            CDS       T00039                                 

Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00620  Pyruvate metabolism
bha00640  Propanoate metabolism
bha00680  Methane metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH3201
   00620 Pyruvate metabolism
    BH3201
   00640 Propanoate metabolism
    BH3201
  Energy metabolism
   00680 Methane metabolism
    BH3201
Enzymes [BR:bha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BH3201
Lipid biosynthesis proteins [BR:bha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BH3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Peptidase_S24 DUF1953
Motif
Other DBs
NCBI-ProteinID: BAB06920
UniProt: Q9K806
Position
complement(3317501..3319084)
Genome map
AA seq 527 aa AA seqDB search
MKVEHMAPEEYNLTEELDVFARDVNRLAIRFLDDKGHRKDISYAELMNTVHQYANALTKC
GLKRGDKVLVVVPRIPEAYYCYLACLKAGIVIIPCSNMLRANDFVYRIQHSEAKAIIAHV
QATDEIDSMSVPLPSLQYKWVISGTKSGWESLEDVARNESVSFEGVKTRRDEMAFLPYTS
GTTGNPKGVVHTHGWAYAHLQTAAKHWLGVREGDLVWATAAPGWQKWVWSPFLSTIGLGA
TAFVYNGPFDPNEYLALLEKEDINVLCCTPTEYRFMAKVDNLNRYRFPHLHSAVSAGEPL
NRKVIEMFRDTFGINVRDGYGQTENTLLVGTMIGMEQRPGSMGKPTLEGQVVIVNEDGQP
VAPHEVGEIAVHKDAAALFKEYYREPERTAQAFRGDYYITGDLARMDEDGFFWFEGRSDD
IIISSGYTIGPFEVEDALTKHPAVKECAVVASPDEDRGAVVKAYIVLKDSTNLDEEALSK
ELQDHVKAHTAPYKYPRKVEFVESLPKTISGKIRRIELRQQEQLRAQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggaacacatggcaccggaagaatacaatctgacggaggaacttgacgtattt
gcaagggacgtaaaccgactcgccattcgatttttagatgataagggtcatcggaaagac
atttcgtatgccgagttaatgaataccgttcatcaatatgcgaatgcgttaaccaagtgc
ggacttaagcggggagacaaagtgcttgtggtggtaccaagaattccagaagcgtattat
tgctatttagcctgtttaaaggcgggaattgttattattccttgttccaacatgcttcgg
gccaacgattttgtttatcgaattcaacattcagaagcaaaagccatcatcgcccatgtt
caagcaaccgatgaaattgacagcatgagtgttcctcttccttcactacagtataaatgg
gttatttcaggcacaaaatcaggatgggaatcgctagaagatgttgcaaggaatgaaagc
gtttcctttgagggtgtgaaaacaagacgggacgaaatggcgtttttgccttacacctcg
ggaacaacaggtaatccaaaaggggttgtccatacccacggttgggcttatgctcatttg
caaacagcagcgaaacattggcttggcgtccgtgaaggagatctcgtctgggcaacggct
gctcctggatggcaaaaatgggtatggagcccgtttttatcaacgatcggtctaggggcg
accgcgtttgtctacaatggtccttttgatccgaacgagtatttagccttgttagagaaa
gaagacatcaatgttctatgctgtacgccaacagaatatcgttttatggcgaaagtagac
aatctcaatcgctaccgttttccccatttgcacagcgcggtgtccgcgggagagccgctg
aatcgaaaggtcattgagatgttccgagacacgtttgggatcaacgtaagggacggttat
gggcagaccgagaacacgcttttagtcgggacgatgattggcatggaacagcgaccagga
tcgatggggaagccaacacttgaagggcaagtcgtcatcgtgaatgaggatggtcagcct
gtggcccctcacgaagtcggagagattgccgtacataaggatgcggctgctttattcaag
gaatattatcgggagcctgagcggaccgctcaagcgtttcgtggagactactacattaca
ggggatctagcaagaatggatgaggatggctttttctggtttgaggggcgcagtgacgat
attattattagttcaggttatacgatcggaccgtttgaagtagaggatgctttgacgaaa
catccagcggtaaaggaatgtgcggttgtcgcgagtcccgatgaagatcgcggagccgtt
gtgaaagcgtatatcgttctgaaagattccacgaatctagatgaggaagcgctcagcaaa
gagttgcaagatcatgtgaaagcgcacaccgctccatacaaatacccaagaaaagtggag
tttgtcgagtcgctaccgaagactatttccggaaaaattaggcgtatcgaattaagacaa
caagagcaattgcgggcacagtaa

DBGET integrated database retrieval system