KEGG   Bacillus halodurans: BH3288Help
Entry
BH3288            CDS       T00039                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bha  Bacillus halodurans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BH3288
Enzymes [BR:bha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BH3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3412591..3413373)
Genome map
AA seq 260 aa AA seqDB search
MWKWEVAEPRGVVVVIHGAGEHHGRYQWLAKKFNSIGLSVVMGDLPGQGRTRGKRGHIQS
FQQYIDVVLEWVEAAKLEHVPIFLFGHSMGGLVAVRTMIEGGTLPVRAVILSSPCFDLYQ
SPGKGKELASKMLHRVTPTFSHHSGIRSDLVTRNEEIREAYLKDELRVTKVSTKWYYELS
KAMRDTRRYPEKFPNVPLLVMQAGEDYITDRKAAWEWFNSVQVTEKAYKEWNGLYHEIFN
EPEREAVFQYTCFFIEQQLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagttgctgagccgcgtggggtggtcgtcgtcattcatggggcggga
gaacaccatgggcgttatcaatggctcgcaaaaaagtttaatagcatcggattatctgta
gtgatgggtgatttgcctggccagggaaggacaagagggaagcgcggtcacattcagtcg
ttccaacagtacattgatgttgtcttggaatgggtggaagcagctaagttggagcacgtg
ccaatcttcttgtttggccacagcatgggcggacttgtagccgttcgcacgatgattgaa
ggaggcacattgccagtgcgtgctgtcattctttcatcaccatgctttgatttatatcag
tcacctgggaaaggaaaagaattggcttcgaaaatgttgcaccgagtaacgcctactttc
tcgcatcattcaggcattcgttccgatttagttactcgaaatgaagagattcgtgaagcc
tacttgaaggatgagcttagagtaacaaaagtgtccacgaaatggtattatgagttatcg
aaggcgatgcgagatacccgtcgttatcctgaaaagttcccgaacgtaccattgcttgtt
atgcaggcgggagaagattatatcacggatagaaaagcggcgtgggaatggtttaattcg
gttcaagtaacggaaaaggcctataaagagtggaatggactctatcatgaaatttttaat
gagcctgagcgggaggctgtgtttcaatacacctgtttttttatcgaacagcaattatca
taa

DBGET integrated database retrieval system