KEGG   Bacillus halodurans: BH3421Help
Entry
BH3421            CDS       T00039                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bha  Bacillus halodurans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BH3421 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH3421 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BH3421 (thrC)
Enzymes [BR:bha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BH3421 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3532560..3533624)
Genome map
AA seq 354 aa AA seqDB search
MSQWRGLLQEYKEFLPVTEETPLLTLGEGNTPLIPLENLSKEWGVKAYVKYEGANPTGSF
KDRGMVMAVAKAKEEGSRTIICASTGNTSAAAAAYGARAGLRCIVVIPEGKIALGKLAQA
VMYGAEVLEIKGNFDHALDIVRSISEKEPITLVNSVNPYRIEGQKTSAFEICDALGQAPD
VLAIPVGNAGNITAYWKGFKEYHEKKGTGLPQMRGFEAEGAAAIVRNQVIEEPETIATAI
RIGNPASWTYAVEAAAESNGKIDEVTDEEILAAYQLLAQKEGVFAEPASCASIAGLRKQI
ASGEIKKGSTVVCVLTGNGLKDPNTAMSTIDVNPAVLPNDEQAFLDHIKGGVPK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtggagaggcttactacaagaatataaagaatttttaccagtaacagaagaa
accccattacttactctaggggaaggaaatacacctttaattccgttggagaacctttca
aaggaatggggagtcaaagcatacgtcaagtacgaaggcgccaatccaacgggttccttt
aaagatcgtggaatggtcatggcggttgccaaagccaaagaagaaggcagtcgaacgatc
atttgcgcttcaacaggaaatacgtcggctgctgcggctgcttacggtgcccgtgcaggg
ttacgttgtatcgttgtaattccagaagggaaaatcgccctcggaaagctggcgcaggcg
gttatgtatggagcggaagtgttagagattaaagggaactttgatcatgcccttgatatc
gtccgttccattagcgaaaaagaaccgattaccctcgtaaactctgtgaatccttatcga
atcgaaggccaaaaaacatcggcatttgaaatctgtgacgcccttgggcaagcgcctgat
gtgctcgcgattcctgtaggaaatgctgggaacattacagcctactggaaaggctttaaa
gaataccacgagaagaaagggactggtctcccgcaaatgcgcggatttgaagcggaaggt
gctgcagccatcgtccgcaatcaagtgattgaagagccagaaaccattgcaaccgccatt
cgcattgggaatccagcgagttggacctatgcagtagaggcggctgccgaatcaaacggg
aaaatcgatgaggtaacagatgaagaaatcttggcagcctatcagttattagcacaaaaa
gaaggtgtgttcgcagagccagcttcatgcgcctccatcgctggtctaagaaaacagatt
gcatcaggagaaataaaaaaaggaagtaccgttgtttgtgtgttaacaggaaacggtttg
aaagatccaaatacggccatgagcacgattgacgtcaatcctgccgtcttgccaaatgat
gaacaggcattcttggatcatattaaaggaggcgttcctaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system