KEGG   Bacillus halodurans: BH3441Help
Entry
BH3441            CDS       T00039                                 

Definition
L-arabinose ABC transporter ATP-binding protein
Orthology
K10548  
putative multiple sugar transport system ATP-binding protein
Organism
bha  Bacillus halodurans
Pathway
ABC transporters
Module
Multiple sugar transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:bha02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3552406..3553959)
Genome map
AA seq 517 aa AA seqDB search
MNMPNCLLEMRNITKAFPGVKALNNVNLKVEQGEIHALVGENGAGKSTLMKVLSGVYPHG
TYEGDILFEGRVCQFKDIKESEQLGIVIIHQELALVPELSIAENIFLGNEQAKNGVIDWN
QTITEAAKLLKKVGLSDSPRTLAMNIGVGKQQLVEIAKALSKKVKLLILDEPTAALNEED
SQNLLHLLLEFKKQGMTSIIISHKLNEISYVADHLTILRDGQSIETLSLQSGEVTEDRII
KGMVGRDLENRFPPREPKIGDVILEVNHWHVDDPLHPDRSLIKDVNLYLKRGEIVGVAGL
MGAGRTELAMSIFGKSYGKNIRGQLIKDGKEIKVHSVKDAIDHGLAYVTEDRKTYGLILI
DDIKHNISLTSLEKLSKNGVVDKTREVKEAEDFRKKMNIRTPSIDQKTGNLSGGNQQKVV
LSKWILSGPDILILDEPTRGIDVGAKYEIYSVIHELAAQGKAVLVISSELPELLGLSDRI
YALCEGRITGEVTREEANQEILMKYMTRTGGNGHEVS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcctaattgtttgttggaaatgcggaacataacgaaagcctttcctggtgtg
aaggcactaaataacgttaatctgaaagtcgaacaaggggagattcatgcattagtaggt
gaaaacggagcgggaaagtctacgttaatgaaagtacttagcggtgtttatccccatggg
acgtacgagggcgatattttatttgaaggtagagtttgtcaatttaaggatattaaagaa
agcgaacagctcggaatcgttattattcaccaggagctagccttagttcccgaattatcg
attgcagaaaatatttttttagggaatgaacaagcgaagaatggagtgattgactggaat
caaacgattactgaggcagcgaaactgctaaaaaaagtcggattatctgattcgccgaga
acgttagcaatgaacatcggggtcggtaagcaacagcttgtggaaattgctaaagcattg
tctaagaaagtgaagctactcattctggatgaaccgaccgccgccttgaatgaagaagat
agtcaaaatttattacatttgctgctggagtttaagaagcaaggaatgacgtcgatcatc
atttctcataagttaaatgaaatatcgtatgtggcagatcatttaacgattttgagagac
ggtcaatcgattgaaacactgtcgctacagagcggagaagtaacagaggatcggatcatt
aaaggaatggtcggacgagacctcgagaaccggtttccgccgcgggagccaaagattggc
gacgtgattttagaagtgaaccattggcacgtggacgacccgctccatccagatcggtcg
ctaatcaaagatgttaacctttacttgaaacgaggggaaattgttggggttgcaggttta
atgggggctggaaggaccgagctagcgatgagcatctttggtaaatcttatggaaagaac
attcgcggtcagctgataaaggatggaaaagaaataaaggtccattcagtaaaggatgcc
attgatcacggtctcgcctatgtaaccgaggatcgtaaaacctatggattgattttaatc
gatgatattaaacacaatatttccttaacgagcttagagaagctatcaaaaaacggtgtc
gttgataaaacacgagaagtaaaagaagctgaggacttccgaaaaaaaatgaacatccgt
acccctagcattgaccagaaaacgggaaatttaagtggtggcaaccaacagaaggtcgtt
ttaagtaaatggatcttatcagggcctgacattttgatattggatgagcccactcgggga
atcgatgtaggggcgaaatacgagatttatagtgtcattcatgagttggctgcccaaggc
aaagccgttctggttatttcttcagagcttccagagctactcggtttaagcgatcggatt
tacgcactatgtgaagggcgaataactggggaggttactcgagaagaggccaatcaagag
atcttaatgaagtacatgacgaggacaggaggaaatgggcatgaagttagctga

DBGET integrated database retrieval system