KEGG   Bacillus halodurans: BH3582Help
Entry
BH3582            CDS       T00039                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bha  Bacillus halodurans
Pathway
bha00340  Histidine metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01230  Biosynthesis of amino acids
Module
bha_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BH3582 (hisD)
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BH3582 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF885 DEAD
Motif
Other DBs
NCBI-ProteinID: BAB07301
UniProt: Q9K6Z2
Position
complement(3683349..3684623)
Genome map
AA seq 424 aa AA seqDB search
MKIVTINDSVSLKRDLDTGTDMQQNAVHSIIAQVREQGDQALFTLTKQFDGADLTTLRVQ
QAEIEAAYREMEEPVLQAIGEAIENIRDFHERQKRNSWMTTKSDGTILGQKITPLDSVGL
YVPGGKAAYPSSIMMNVIPAQVAGVQNIVIVSPPQKDGSIPAGVLVTAAELGVKTILKVG
GAQAIAALAYGTESVPAVDKITGPGNIYVALAKRAVFGHVDIDMIAGPSEIVVLADERAN
PRYIAADLLSQAEHDERASAILVTPSRALAEEVAVEVDQQLTTLPKREIAAASIRDYGAI
YVTETLEEAVSVVNELAPEHLEILAEEPMSFLGKIRHAGAIFLGPYSSEPVGDYFAGPNH
VLPTNGTARFSSPLNVDDFVKKSSIISYSKAALLENGAKISALARLEGLEAHARAIDIRL
EDER
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtaacaataaatgattcggttagcttaaaacgagatttagatacggggacg
gatatgcagcaaaatgccgtccattcaattattgcccaagtacgcgaacagggagatcaa
gccctttttacattaaccaagcaatttgatggtgccgacttgacaactttacgtgtgcag
caagccgagatcgaagcagcgtaccgagaaatggaggagcctgtacttcaagcgatcggc
gaggcgattgaaaacattcgcgattttcatgaacggcaaaaaagaaattcatggatgacg
acaaagtcggacggaacgattctcggacaaaaaataaccccccttgattctgtcggtctt
tacgttccaggtggtaaagcagcctatccatcttcgatcatgatgaatgtcatcccagcc
caagtggcgggagtacaaaatattgtgatcgtttcaccaccgcaaaaagatggctccatc
ccggccggtgttcttgtaacagcggctgagttaggagttaagacgattttaaaagttggg
ggtgctcaggcgatcgctgccttagcctatggtactgaatcagtccctgccgttgataaa
attacgggccctggtaacatttatgtcgctttagcaaaacgggctgtttttggtcatgtg
gacattgacatgatcgcaggtccatcggagattgttgtgttggctgacgaacgagcgaat
ccgcgctacattgcagctgatttattgtctcaggccgagcatgatgaacgtgcctccgcc
attctcgtcacgccatcaagagcgttagccgaagaggtggcagtagaagtggatcaacag
ctcacaactttaccgaagcgggaaattgcggctgcttccattcgtgattacggggcaatc
tacgtaacggaaacgttggaggaagccgtatctgttgtaaatgagcttgcgccagagcat
ctagaaattttagcagaagagccaatgtccttcttgggaaaaatccggcatgcaggggcg
atctttttaggtccatacagctcggagcctgtaggtgattactttgccggaccgaatcac
gtacttccaacgaatgggacggctcggttttcaagtccattaaatgtggacgatttcgtg
aaaaaatcaagcattatttcctatagcaaagcagctctattggagaacggtgcaaaaatt
tctgcacttgcccggctagaaggactggaagctcacgctcgagcaattgacattcgattg
gaggatgaacgatga

DBGET integrated database retrieval system