KEGG   Bacillus halodurans: BH3652Help
Entry
BH3652            CDS       T00039                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bha  Bacillus halodurans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BH3652
   00052 Galactose metabolism
    BH3652
   00500 Starch and sucrose metabolism
    BH3652
   00520 Amino sugar and nucleotide sugar metabolism
    BH3652
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BH3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3757546..3758439)
Genome map
AA seq 297 aa AA seqDB search
MHVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIESGIEDIIVVTGRGK
RAIEDHFDKSFELEETLEKKNKSKLLEEVKAISSMTNIHYIRQKEANGLGHAIWCARKFI
GNEPFAVLLGDDIVQSDVPCLKQLIDVFDRYHSSVVGVQEVPNEDVSKYGIVSPKGSEIE
ANVIHAAGFVEKPKLEEAPSNYAIMGRYVLRPEIFDILENLPPGAGGEIQLTDAIKVLNE
SQVVLAYNFDGVRYDVGDKFGFIKATIDLALQRDDLSEDVAQYIKDIYEKQVGQLKQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtaaaaaaagccatcatccctgcggcaggtctagggacaagatttctcccagca
acgaaagcgcaaccgaaagaaatgttaccgatcgttgataagccaacgattcaatatatt
atcgaagaagcgattgaatcgggaattgaagatattatcgttgtgactggtagagggaag
cgtgcgattgaagatcacttcgataaatcctttgagttagaagaaacgctagaaaagaaa
aacaagtctaaattgctagaagaagtaaaggcgatttcgagcatgacgaatattcattac
atccgtcaaaaagaggccaatgggttagggcatgcgatttggtgtgctcgcaaatttata
gggaatgaaccgtttgccgttctactaggagacgatattgtccagtcggatgttccatgc
ttaaagcagctaattgatgtttttgaccgctatcattcgtcggttgttggggttcaggaa
gtgcctaatgaagatgtctccaagtatgggattgtttctccgaaagggtcagagattgaa
gcgaacgttattcacgccgctggctttgtcgaaaagccaaagctagaagaggcgccttcc
aattatgcgattatgggaaggtatgtgcttcgcccggaaatttttgatattctagagaac
ctacctccaggtgctggcggcgagattcagttaaccgatgcgataaaggtcttgaatgaa
tctcaggtcgtgttagcctacaattttgacggtgttcgttacgacgtgggggacaagttt
ggctttattaaagcaacaattgatttagccttacaacgggatgatttgtcagaagatgta
gctcagtatattaaggacatttatgaaaaacaagtgggtcagttaaagcaataa

DBGET integrated database retrieval system