KEGG   Bacillus halodurans: BH3810Help
Entry
BH3810            CDS       T00039                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bha  Bacillus halodurans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BH3810
Enzymes [BR:bha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BH3810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3932542..3932706)
Genome map
AA seq 54 aa AA seqDB search
MRFDEAYSGKVFIMSRSNYEKSKAVIFGMPMDWTVSFRPARVSVQTVSVKLLSG
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgatgaagcctattcaggcaaagttttcattatgagtcgttcaaactatgag
aaaagcaaggcggttatttttggaatgccgatggactggacggtgtcgttccgcccagct
cgcgtttcggtccaaaccgtatccgtgaagcttctctcgggctag

DBGET integrated database retrieval system