KEGG   Bacillus halodurans: BH3940Help
Entry
BH3940            CDS       T00039                                 

Definition
1-pyrroline-5-carboxylate dehydrogenase (EC:1.5.1.12)
Orthology
K00294  
1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bha  Bacillus halodurans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bha00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bha00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4077546..4079093)
Genome map
AA seq 515 aa AA seqDB search
MLTPYKHEPFTDFSVEENRSAFEAALKNVEGELGKDYPLVINGERVTTDDKIVSVNPAMK
EQVIGVVSKASREIVDDAFKSAETAFHTWKNVNPEERANILIRAAAIIRRRKHEFSAWLV
KEAGKPWKEADADTAEAIDFLEYYARQMITLKDGKPVNSREGEHNRYFYTPIGVCVTISP
WNFALAIMAGTTVAPIVTGNTVLLKPASTTPVVAAKFVEVLEEAGLPKGVVNFVPGSGTD
IGDYLIDHPKTSLITFTGSRDVGVRLYERAAVVHPGQQHLKRVIVEMGGKDTVVVDKDAD
LDLAAQSIVTSAFGFSGQKCSAGSRAVIHQDVYDVVLEKAVALTKQLSVGEPTAPDVYMG
PVVDQGAFSKIMSYIEVGKEEGRLMVGGEGDDSKGFFIQPTIFADVDPHARIMQEEIFGP
VVAFSKARDFDHALEIANNTEYGLTGAVITTNRHHIEKAKRDFHVGNLYFNRNCTGAIVG
YHPFGGFKMSGTDSKAGGPDYLALHMQAKTVSEMY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaccttataagcatgaaccgtttacagattttagtgtagaagaaaaccgcagc
gcgtttgaggctgccttaaagaacgttgaaggggaattagggaaagactacccgttagtg
atcaatggggaacgtgtgacgaccgatgataaaatcgtttccgtgaatcctgccatgaaa
gagcaagtgatcggcgtcgtctcaaaagcaagtcgcgagatagtagatgatgcatttaaa
tcggcagagacggcatttcatacgtggaaaaacgtcaatcctgaagagcgagcgaacatc
ttaatcagagcggccgcgatcattcgccggagaaagcatgagttttcggcatggctcgtg
aaagaagcgggtaagccttggaaagaagccgatgcagacacagcggaagcgatcgacttt
ttagagtactacgcccggcaaatgattacgctaaaggatggaaagccagtcaatagtcgc
gagggtgagcataatcgctacttctatacaccgatcggggtatgtgtcacaatctcgcct
tggaatttcgccttggcgattatggctggaacgacggtagcgccaattgtaacagggaac
accgtcttactgaaaccagctagcacgacccctgttgtcgccgcaaagttcgtcgaagtt
cttgaagaagcaggtttgccaaagggtgtggtcaacttcgtcccaggaagtggaacagac
atcggtgactacttgatcgatcatccaaaaacaagcttgatcacatttaccggttcgcgt
gacgtgggagtccggctttatgaaagggcagcggttgttcatccaggtcaacagcatttg
aagcgcgtcattgtagagatgggaggaaaagataccgttgttgtcgataaggatgccgat
ctcgatttagctgctcaatcgatcgtgacctcggccttcggcttttctggacaaaaatgt
tctgcaggttcgagagctgtcatccatcaagacgtctatgatgttgtgttagagaaggcc
gtggccctcacgaaacaactctcagtaggcgaaccgacggcacctgacgtctatatggga
cctgtcgtcgatcaaggagctttttcgaaaattatgagctatatcgaagtggggaaagag
gaaggccgattgatggtcggaggtgaaggagatgattcaaaaggcttcttcattcaaccg
acgatctttgctgacgtagatccccatgcgcgaatcatgcaggaagagattttcggtcca
gtcgttgccttcagtaaggcaagggattttgatcatgcgctagaaatcgccaataatacc
gagtacggtctgacaggagctgtcattacaacgaaccgtcaccatatcgaaaaagcgaag
cgagacttccatgtaggaaatctatactttaaccggaattgcacaggcgcgattgtcggc
taccacccattcggcggctttaaaatgtcaggcaccgattcaaaagctggaggacctgat
tatttggcccttcatatgcaagcaaaaaccgtctccgaaatgtattaa

DBGET integrated database retrieval system