KEGG   Bacillus halodurans: BH3948Help
Entry
BH3948            CDS       T00039                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bha  Bacillus halodurans
Pathway
bha00220  Arginine biosynthesis
bha00330  Arginine and proline metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01130  Biosynthesis of antibiotics
bha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BH3948
   00330 Arginine and proline metabolism
    BH3948
Enzymes [BR:bha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BH3948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAB07667
UniProt: Q9K5Y7
Position
complement(4086762..4087667)
Genome map
AA seq 301 aa AA seqDB search
MNKFQKVSIIGVPMDLGQKRRGVDMGPSAMRYAGLIEEIEALGFEVKDYGDIPINRPATS
ETQEGPLRNLDEVVKVSEELCKGVAAIEAEHSFPLILGGDHSISIGSIAGIRKSYNNLGV
IWYDAHPDLNTEETSPSGNIHGMPLAVNLGIGHERLMNIGGITPKVKPEHIVIIGARSID
EGERQLIREQGIKVYTMHEVDRMGMTRVIEETIDYLSARTDGVHLSFDLDGIDPVDAPGV
GTPVLGGISYRESHLALEMLAESELITSAEFVEINPILDNKNQTANVAVALVTSLLGKKL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttcaaaaagtttcgattattggagtgccaatggatttaggacagaagcgt
cgaggggttgatatgggaccgagcgcgatgcgatatgccgggttaattgaagagattgag
gcccttgggtttgaagtaaaagattatggggatattccgatcaatcgcccagcaacgagt
gagactcaggaggggccgctcagaaatctggatgaagttgtaaaggtgagtgaggagttg
tgcaaaggggttgcggcaatcgaagcagagcatagcttccctctcattttaggcggcgac
catagcattagcatcggttcgattgcaggtatcagaaaaagctacaataaccttggggtc
atttggtatgatgcccatccggatttaaatacagaagagacatcaccatctggaaatatt
catgggatgccgttggcggttaatcttggcatcgggcatgagcggttaatgaacataggg
ggcattactccgaaagtgaaacctgaacatattgtcattatcggggctcgctcgatcgat
gagggagaacggcaactcattagggaacaaggcattaaagtttatacgatgcacgaagtt
gatcgaatgggcatgacgagagtgattgaagagacgattgactatctttctgcccgcacc
gatggcgtccatttaagctttgatttggatgggattgatccagtcgatgcaccaggggta
ggcacaccggtattaggggggatttcgtatcgggagagtcatttagccctggaaatgctc
gcggaatcggaattgattacgtcagctgaattcgtggagattaatccaattctcgataac
aaaaaccaaacggcaaacgtggcggttgcgttagtgacctcgcttttaggaaagaagcta
ctctaa

DBGET integrated database retrieval system