KEGG   Bartonella henselae Houston-1: BH01750Help
Entry
BH01750           CDS       T00180                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bhe  Bartonella henselae Houston-1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BH01750 (galU)
   00052 Galactose metabolism
    BH01750 (galU)
   00500 Starch and sucrose metabolism
    BH01750 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BH01750 (galU)
Enzymes [BR:bhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BH01750 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240324..241223
Genome map
AA seq 299 aa AA seqDB search
MKVRKIRKAVFPVAGLGTRFLPATKTIPKEMLTVVDKPVIQYVVDEAREAGIEHFIFVTG
RNKAVIEDYFDTQVELYTTLAERGKRGELDHLQALQLPPGTTSFTRQQQPLGLGHALWCA
RELVGEEPFALLLPDMLIQAKKSCLSEMVNLYEKTAGGNIVAVQECDPGEAHKYGIVGKG
KQIANGFEITKMVEKPKKGTAPSNLYINGRYILQPEIFNILSDQERGSGNEIQLTDAMMR
LLNEQDFFGFQLEGRTFDCGSKAGFIEANVAFSLARADMHSQVSASLKNLLEIIKIEKL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcgtaaaattcggaaagcagtatttcccgtggctggtcttggtacgcgtttt
ctacctgcaacaaaaacaattcctaaagaaatgctaactgttgttgataagcctgttatt
caatatgtagtagatgaagcacgtgaagcaggtattgagcattttatttttgtgactgga
cgtaataaagcagtcattgaggattattttgatacgcaagttgaattatatacaacactt
gccgaacgtggtaagagaggagaacttgatcatttacaagctttacaacttccaccaggg
acaacttctttcacgcgccaacaacagcctttggggctaggacatgctctttggtgcgcg
cgtgagttagttggggaggaaccttttgctttattgttacccgatatgcttatacaagct
aaaaagagttgcctttctgagatggttaatctttatgagaaaaccgctggtggcaatatt
gtcgcggttcaggagtgtgatcctggagaagcacataaatatggtattgttggaaaaggc
aaacagattgcaaatggttttgaaattacaaaaatggtagaaaaaccaaaaaaaggaaca
gctccttcgaatttatacatcaatgggcgttatatcttacaaccagaaatttttaatatt
ctctccgatcaagaacgaggatcaggaaacgaaattcagttaacagatgcgatgatgcgg
cttttaaatgagcaagatttttttggttttcagttagaggggcgcacttttgattgtggt
tctaaagctggttttattgaagctaacgttgcattttctttagcacgcgctgatatgcac
agccaagtttctgcctcattgaaaaatttactagaaatcattaaaatagaaaagttatag

DBGET integrated database retrieval system