KEGG   Bartonella henselae: BH01950Help
Entry
BH01950           CDS       T00180                                 

Gene name
nrdF
Definition
ribonucleotide-diphosphate reductase subunit beta (EC:1.17.4.1)
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bhe  Bartonella henselae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bhe00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bhe00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
264593..265567
Genome map
AA seq 324 aa AA seqDB search
MTKITTKNPVVCAVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSNDIPSWASLTEEERKL
TIRVFTGLTLLDTIQNTVGAISLMADAITEHEEAVLTNIAFMEAVHARSYSSIFSTLCST
VEVDDAFRWSEENIHLQKKARLVLERYEGNDPLKKKIASTLLESFLFYSGFYLPMYWASR
AKLTNTADLIRLIIRDEAVHGYYIGYKFQLGFAKLDETKKKEVKDFAFNLLFDLYNIECK
YTEDLYDALGLTEDVKIFLHYNANKALMNLGFEALFPSEVCRVNPAILAALSPNSDENHD
FFSGAGSSYVIGKAVATTDDDWEF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagattacaactaaaaatcctgttgtgtgcgctgtcaattggaatagattgcat
gatgagaaagatcttgaggtttggaatcgtttaacgggaaatttttggttgcctgaaaag
gtgccgctttccaatgatattccttcatgggcaagtctaacggaagaagaacgcaagtta
accattcgtgtttttacagggttaacacttctggatacgattcaaaatactgtaggtgct
atttcgcttatggctgatgcgataacagagcatgaggaggcagtgttaacgaacattgct
tttatggaagcggttcatgcacgttcttattcttctattttttcaacattgtgttcgacg
gtagaagttgatgatgcttttagatggtcagaggaaaatattcatttacaaaaaaaagcc
agattagttcttgagcgttatgaaggaaatgacccactcaagaagaagattgcctcgact
ttacttgaaagctttttattttattctggtttttatttacccatgtattgggccagccgt
gctaaattgaccaatacagctgatctcattcggcttatcattcgtgatgaagcagtccat
ggttattatataggttataaatttcaattagggtttgcaaaacttgatgaaaccaaaaag
aaggaagttaaggattttgcttttaacttgctctttgacctttataatattgaatgtaaa
tatactgaagatctttatgatgcacttggattgacagaagatgttaaaatttttcttcat
tataatgcaaacaaggctttaatgaatttaggttttgaagctcttttcccgtctgaggtt
tgtcgtgttaatcctgctattttagccgctttatcaccaaactctgatgaaaatcatgat
tttttttcaggagctggctcttcttatgttattggcaaggcggttgctaccacggatgat
gattgggagttttaa

DBGET integrated database retrieval system