KEGG   Bartonella henselae Houston-1: BH02370Help
Entry
BH02370           CDS       T00180                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bhe  Bartonella henselae Houston-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BH02370
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BH02370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313464..314015
Genome map
AA seq 183 aa AA seqDB search
MNRSKIVYFVFACLFLLIILVGILSYRIYDNSASVQPSKVTKNDRLKEKQQTSDISLSLN
DRLQRANIENGRKIFRQCGLCHTSGRHESNRVGPALWGIIDRPLAAKTDFAYSRVLRANS
DQRWDFMTLDRYLQSPREAFPGTIMFFRGIKNDQDRADLLLYLRGLSDDPVPLPNDKKED
KPG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctcaaaaattgtctattttgtttttgcttgcttatttttgctgattatcttg
gtgggaattttaagctacaggatttatgataattctgcgtcggttcaaccttctaaagtt
acaaaaaatgatagactcaaagaaaaacagcagacatctgatatttctttatcattaaat
gatcgtcttcaacgagccaatattgaaaatggacgtaagatttttcgtcaatgtggtctg
tgccatacctcggggcgtcatgaatctaatcgtgttggtccagcactttgggggatcatt
gaccgtcctttggcagctaagacagattttgcttattcacgtgtattgcgtgcaaattct
gatcagagatgggattttatgactttggatcgttatctgcaatcaccacgtgaagcgttt
ccagggacgattatgttttttcgtgggatcaaaaatgaccaagatcgtgccgatcttttg
ctttatttacggggtttatccgatgaccctgttcccttaccgaacgataaaaaagaagac
aagccaggctga

DBGET integrated database retrieval system