KEGG   Bartonella henselae: BH02370Help
Entry
BH02370           CDS       T00180                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bhe  Bartonella henselae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bhe00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bhe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313464..314015
Genome map
AA seq 183 aa AA seqDB search
MNRSKIVYFVFACLFLLIILVGILSYRIYDNSASVQPSKVTKNDRLKEKQQTSDISLSLN
DRLQRANIENGRKIFRQCGLCHTSGRHESNRVGPALWGIIDRPLAAKTDFAYSRVLRANS
DQRWDFMTLDRYLQSPREAFPGTIMFFRGIKNDQDRADLLLYLRGLSDDPVPLPNDKKED
KPG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctcaaaaattgtctattttgtttttgcttgcttatttttgctgattatcttg
gtgggaattttaagctacaggatttatgataattctgcgtcggttcaaccttctaaagtt
acaaaaaatgatagactcaaagaaaaacagcagacatctgatatttctttatcattaaat
gatcgtcttcaacgagccaatattgaaaatggacgtaagatttttcgtcaatgtggtctg
tgccatacctcggggcgtcatgaatctaatcgtgttggtccagcactttgggggatcatt
gaccgtcctttggcagctaagacagattttgcttattcacgtgtattgcgtgcaaattct
gatcagagatgggattttatgactttggatcgttatctgcaatcaccacgtgaagcgttt
ccagggacgattatgttttttcgtgggatcaaaaatgaccaagatcgtgccgatcttttg
ctttatttacggggtttatccgatgaccctgttcccttaccgaacgataaaaaagaagac
aagccaggctga

DBGET integrated database retrieval system