KEGG   Bartonella henselae: BH02950Help
Entry
BH02950           CDS       T00180                                 

Definition
Phage related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bhe  Bartonella henselae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(374890..375552)
Genome map
AA seq 220 aa AA seqDB search
MRTISQEGLALIKQWEGLRLNAYKDAIGVWTIGYGHTNNAGKPFVYKGMAITEKQAEELL
CQDLRQFENTVEQAVQVSLTDEQFAALVSFCYNVGTTAFCNSTLLRKLNSGDYEAIPTEL
QKWTKAGGKRLQGLVHRRAAEAGLWAKGAFVSSNYQTVETQAPTGLFKAEALAPVIGSFS
GLGGLLAGNGPVQWALATIMVLAACAGIFFVAKRFQEHRL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaatatcacaagaaggactagcactgattaaacaatgggaaggtttgcgtttg
aatgcctataaagatgccattggggtatggacaatcggttatggacatacaaacaatgcc
ggaaaaccttttgtttacaaaggcatggcaatcactgaaaaacaagctgaagaacttctt
tgccaagatttaagacaatttgaaaataccgttgaacaagcggttcaagtttccttaacg
gatgaacaattcgcggcattggtctccttttgctataatgtaggaacaacagctttttgc
aattcgaccttgttaaggaaactcaatagtggcgattatgaagcgatcccaaccgaatta
cagaaatggaccaaagccggtggtaagcgcttacaaggtcttgtacaccggcgtgcagct
gaagcaggattatgggcgaaaggtgcttttgtttcctcgaattaccaaaccgtagaaacg
caagcaccaacagggcttttcaaagccgaagcccttgcaccagtcattggttctttttct
gggcttggtggcttattagccggcaatggtccagtgcaatgggcgctcgccactatcatg
gttttagccgcctgtgctggcattttctttgttgctaaacgttttcaggaacaccgttta
tga

DBGET integrated database retrieval system