KEGG   Bartonella henselae: BH04210Help
Entry
BH04210           CDS       T00180                                 

Gene name
thrB1
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bhe  Bartonella henselae
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bhe00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484560..485468
Genome map
AA seq 302 aa AA seqDB search
MISNGQAFFQAPSYLFTPIKLNLALHVVGQRADGYHLIESLVYFSLSGDCLSCTPFGSNR
FVLTGPFADELVSDAENLVVRAHDFMCNTFPECAKPAFFQLVKLLPVASGVGGGSGNAAG
VLSLLRQQWALDCSCEKLAEMSLVLGADVPMCLFALEYQQPLFVKGIGQDITRLKEACSL
AMVLVNHGQQIATKTVFKALEKRDHPPLKIDSAALKTVDSLVEALQETRNDLFVPALKIA
PQLSEVLCALDESGALFSRMSGTGATCFGIFKDKQAAQQAALFIKAMYPDWFVKPIVTLA
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgaatggacaagctttttttcaagcgccttcttatttatttacccctattaaa
ttgaacttagctttgcatgttgtagggcaacgcgctgatggttatcatttaatagaaagt
ttggtttattttagtctcagtggtgattgtttaagctgcacaccttttgggagtaaccgc
tttgttttaacaggtccttttgcagatgagcttgtttctgatgcagaaaatttggttgtt
cgtgcacatgattttatgtgtaacacctttcctgaatgtgctaaacctgctttttttcaa
cttgttaaattattgccggttgcttcaggggttggtggtggttcgggtaatgctgctggt
gttttgagtctgttgcgtcagcaatgggctcttgattgctcttgtgaaaaattagcggaa
atgagtttagttcttggcgctgatgtaccaatgtgtctttttgcattggagtatcagcag
ccactttttgttaaaggaattgggcaagatataacacggctaaaagaggcttgttctctt
gcaatggttttagttaatcatggtcaacagattgcgacaaaaactgtttttaaggcttta
gagaagcgcgatcatccacccttgaaaattgattcggcagctctaaagacggttgattca
ttggttgaagctttacaggaaacgcgtaacgatctttttgttcctgccttaaaaattgca
cctcaactgtctgaggttttatgtgcattagatgagagtggagctcttttttctcgcatg
tccgggactggtgcaacttgttttggtatttttaaagataagcaagcagcgcaacaggct
gctctttttattaaagcgatgtatccagactggtttgttaaacctattgtaactttagca
aagctctag

DBGET integrated database retrieval system