KEGG   Bartonella henselae Houston-1: BH04480Help
Entry
BH04480           CDS       T00180                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bhe  Bartonella henselae Houston-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BH04480 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH04480 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BH04480 (thrC)
Enzymes [BR:bhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BH04480 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(516419..517816)
Genome map
AA seq 465 aa AA seqDB search
MQYISTRGEAPALGFIETIMTGLASDGGLYLPEKFPQLSFDALRALRGQSYMTIAKTILW
PFVNNEIEYTSFENMISESYATFHHPATCPLLQTGPNEFILELFHGPTLAFKDVAMQFLS
RLMDYVLIKKNKSATIIAATSGDTGGAAIQAFAGREYSDVFILFPKGRISPVQQRQMTTS
QKTNVHAIAIEGSFDDCQALVKAMFNDHNFRQKKALSGVNSINWARIMAQIVYYFSSALS
LGAPDRAVSFTVPTGNFGDIFAGYVAARMGLPIAQLVIATNDNDILVRTLTNGTYETQPT
THTTSPSMDIQVSSNFERLLFESGDRDPVWIRNAMENLKKSGYFNLNEKQLKNIRSLFSA
GKSSIAETAKIIDSVYKESGYLVDPHTAVALKVARENRQPHIPMIVLSTAHPAKFPDAIK
NACGLNAPWPSRLNDLIEREEHFIGLANDEKIVKDYISLKSRASY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatcagcacgagaggtgaggctcctgctttaggttttattgaaactatcatg
actggactggctagtgatggtggactttatcttccagaaaaattcccccaattatcattc
gatgcattacgagcgcttcgtggccaatcctatatgacaatcgctaaaactattctttgg
ccctttgtgaataacgaaattgaatatacttcttttgaaaatatgatttctgaatcttat
gctaccttccatcatcctgcaacctgtccgttactgcaaactggcccaaatgaatttatt
cttgaactttttcacggtcctactttggcatttaaagatgttgcaatgcagtttctttct
cgactgatggattatgtgctcatcaaaaaaaataaatccgcaacaattattgctgctaca
tcaggtgatacaggtggtgccgcaatacaagcttttgctggaagagaatattcagacgtt
tttatcttgtttcctaaagggcgtatatcacccgttcagcagcggcaaatgacgaccagt
caaaaaacaaacgtgcatgccatagccattgaagggagttttgatgattgccaagcactg
gtgaaagcaatgtttaatgaccataatttccggcaaaaaaaagcactttcaggagttaat
tctataaattgggcgcgtattatggcgcaaattgtttattatttttcatccgcactttct
ttaggtgctcctgatagagctgtctcatttactgttcctactggaaattttggtgatatt
tttgcgggttatgttgctgcccgtatgggattacccattgcccaattggtcattgcaaca
aatgataatgatatcctcgtgcgcacattgactaatggtacttatgaaacacagccgaca
acccacacaacgtcaccctctatggatattcaagtctcttctaattttgaacgcttactg
tttgaaagtggcgatcgtgatcctgtgtggattcgcaatgcgatggaaaacttgaaaaag
tcaggatattttaatcttaatgaaaagcagctcaaaaatattcgttccctcttttctgca
gggaaaagtagcatagctgaaacggcaaaaataattgacagtgtttataaggaaagcggc
tatctcgttgatccacatacagctgttgcgcttaaagtagcccgtgaaaacagacaacca
catattccaatgatcgtcctctctactgctcatcctgctaaatttcctgatgccatcaaa
aatgcctgtggacttaatgctccatggccatctcgtctcaacgatttaatagaacgcgaa
gaacattttataggtcttgctaatgatgaaaaaatagtaaaagattacatttctttaaaa
tcgcgtgcatcttattaa

DBGET integrated database retrieval system