KEGG   Bartonella henselae Houston-1: BH04480Help
Entry
BH04480           CDS       T00180                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bhe  Bartonella henselae Houston-1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH04480 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BH04480 (thrC)
Enzymes [BR:bhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BH04480 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(516419..517816)
Genome map
AA seq 465 aa AA seqDB search
MQYISTRGEAPALGFIETIMTGLASDGGLYLPEKFPQLSFDALRALRGQSYMTIAKTILW
PFVNNEIEYTSFENMISESYATFHHPATCPLLQTGPNEFILELFHGPTLAFKDVAMQFLS
RLMDYVLIKKNKSATIIAATSGDTGGAAIQAFAGREYSDVFILFPKGRISPVQQRQMTTS
QKTNVHAIAIEGSFDDCQALVKAMFNDHNFRQKKALSGVNSINWARIMAQIVYYFSSALS
LGAPDRAVSFTVPTGNFGDIFAGYVAARMGLPIAQLVIATNDNDILVRTLTNGTYETQPT
THTTSPSMDIQVSSNFERLLFESGDRDPVWIRNAMENLKKSGYFNLNEKQLKNIRSLFSA
GKSSIAETAKIIDSVYKESGYLVDPHTAVALKVARENRQPHIPMIVLSTAHPAKFPDAIK
NACGLNAPWPSRLNDLIEREEHFIGLANDEKIVKDYISLKSRASY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatcagcacgagaggtgaggctcctgctttaggttttattgaaactatcatg
actggactggctagtgatggtggactttatcttccagaaaaattcccccaattatcattc
gatgcattacgagcgcttcgtggccaatcctatatgacaatcgctaaaactattctttgg
ccctttgtgaataacgaaattgaatatacttcttttgaaaatatgatttctgaatcttat
gctaccttccatcatcctgcaacctgtccgttactgcaaactggcccaaatgaatttatt
cttgaactttttcacggtcctactttggcatttaaagatgttgcaatgcagtttctttct
cgactgatggattatgtgctcatcaaaaaaaataaatccgcaacaattattgctgctaca
tcaggtgatacaggtggtgccgcaatacaagcttttgctggaagagaatattcagacgtt
tttatcttgtttcctaaagggcgtatatcacccgttcagcagcggcaaatgacgaccagt
caaaaaacaaacgtgcatgccatagccattgaagggagttttgatgattgccaagcactg
gtgaaagcaatgtttaatgaccataatttccggcaaaaaaaagcactttcaggagttaat
tctataaattgggcgcgtattatggcgcaaattgtttattatttttcatccgcactttct
ttaggtgctcctgatagagctgtctcatttactgttcctactggaaattttggtgatatt
tttgcgggttatgttgctgcccgtatgggattacccattgcccaattggtcattgcaaca
aatgataatgatatcctcgtgcgcacattgactaatggtacttatgaaacacagccgaca
acccacacaacgtcaccctctatggatattcaagtctcttctaattttgaacgcttactg
tttgaaagtggcgatcgtgatcctgtgtggattcgcaatgcgatggaaaacttgaaaaag
tcaggatattttaatcttaatgaaaagcagctcaaaaatattcgttccctcttttctgca
gggaaaagtagcatagctgaaacggcaaaaataattgacagtgtttataaggaaagcggc
tatctcgttgatccacatacagctgttgcgcttaaagtagcccgtgaaaacagacaacca
catattccaatgatcgtcctctctactgctcatcctgctaaatttcctgatgccatcaaa
aatgcctgtggacttaatgctccatggccatctcgtctcaacgatttaatagaacgcgaa
gaacattttataggtcttgctaatgatgaaaaaatagtaaaagattacatttctttaaaa
tcgcgtgcatcttattaa

DBGET integrated database retrieval system