KEGG   Bartonella henselae Houston-1: BH05390Help
Entry
BH05390           CDS       T00180                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe00230  Purine metabolism
bhe01100  Metabolic pathways
Module
bhe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BH05390 (gmk)
Enzymes [BR:bhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BH05390 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAF27347
UniProt: Q6G439
Position
626035..626703
Genome map
AA seq 222 aa AA seqDB search
MVTFFENELSAKKRNQRRGFLFILSSPSGAGKSTLSRLLLKDGKLELSISMTTRQKRPSE
VDGLHYHFISKKEFKRKRDGNEFIEWAEVHGNYYGTLRESVENVLSTGRDMLFDIDYQGT
KQLQKKMPGDTVSVFILPPSMKELISRLYRRAEDSQDIINLRLKNARTEMQHWRSYDYVI
INENLNQSVSLIKSIYLAETVKRERCFFLEPFINGLIAEKID
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccttctttgaaaatgaattgagtgctaaaaaaagaaatcaacgtcgcggtttt
ttatttattctctcttcaccttcaggagctggtaaatcaaccctttctcggttacttttg
aaagatggaaaattagaactttctataagtatgacaacacggcaaaaacgtccaagtgaa
gtggatggccttcattatcattttatttcaaagaaagagtttaaacgtaagcgcgatggt
aatgagtttattgaatgggcagaagttcatggaaattattatggcactttacgtgagagc
gttgaaaacgtgttgagtactggtagagatatgttatttgatattgattatcaaggcaca
aaacagcttcaaaaaaagatgccaggagatactgtttctgtttttattcttccaccgtca
atgaaagagcttatttcacgtttatatcgtcgagcagaagatagccaagatatcatcaat
ttacgcttgaaaaatgcacgaacagaaatgcagcattggcgttcttatgattatgtaatt
attaatgaaaatttaaatcaatccgtgtcacttattaaatcgatttatttagcggaaaca
gtaaaacgcgaacgatgtttctttcttgagccttttattaatgggcttattgctgaaaag
attgattaa

DBGET integrated database retrieval system