KEGG   Bartonella henselae Houston-1: BH05680Help
Entry
BH05680           CDS       T00180                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bhe  Bartonella henselae Houston-1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BH05680 (tpiA)
   01230 Biosynthesis of amino acids
    BH05680 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH05680 (tpiA)
   00051 Fructose and mannose metabolism
    BH05680 (tpiA)
   00562 Inositol phosphate metabolism
    BH05680 (tpiA)
Enzymes [BR:bhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BH05680 (tpiA)
Exosome [BR:bhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BH05680 (tpiA)
  Exosomal proteins of bladder cancer cells
   BH05680 (tpiA)
  Exosomal proteins of melanoma cells
   BH05680 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
667614..668378
Genome map
AA seq 254 aa AA seqDB search
MSPNIRPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALICVPATLLSRAFDILGG
ENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAA
WRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWAVGTGNTA
TSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLK
AIDFLTICDVYRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaatattcgaccttttattgcgggaaattggaaaatgaatggaactggtgaa
tctcttggagaattacgtgccattgccgctggcattagctctgatttaggtcgtttgttt
gaagcgcttatttgtgttccagcaacgcttttatcccgtgcttttgatattctgggtgga
gaaaatattctcttaggagggcaaaattgtcattttgatgattatggtccttatactgga
gatatttcagcttttatgcttaaagaagcaggagcaagtcatgtcattattgggcattca
gagcgtcgcacagtttatcaggaaagtgatgcaattgttcgtgctaaagtgcaagcggca
tggcgagcaggtcttgttgctcttatttgtgttggagaaacattggaagaacgcaaaagt
aataaagtgttggatgtgcttacgcggcaacttgaaggatctttaccagatggtgcaaca
gcagaaaatatcattatcgcttatgaacctgtatgggctgtagggacaggcaatacagcg
acttcagcagatgttgcagaggtacatgcgtttattcaccataagatgcattctcgtttt
ggtgatgagggggccaagatacgtttgctgtatggtggatcagtaaaaccatccaatgca
ttcgagcttctgagtactgctcatgtgaatggtgctctgataggtggagcaagtttaaaa
gcgattgattttttaactatttgcgatgtttatcgtaaattataa

DBGET integrated database retrieval system