KEGG   Bartonella henselae Houston-1: BH07290Help
Entry
BH07290           CDS       T00180                                 

Definition
(GenBank) Lysophospholipase l2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BH07290
Enzymes [BR:bhe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BH07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1
Motif
Other DBs
NCBI-ProteinID: CAF27531
UniProt: A0A0R4J8I7
Position
complement(840745..841647)
Genome map
AA seq 300 aa AA seqDB search
MERSLYSPDLRIPPANIHNNHLKIDTDRKIRFAITHPEIKKAKGTIVILESYANALEEYF
LPMNEISNRGFYTAIFDWFGREESQPDKQKQSRYNYFNINNDINDLNEFLKNIVYCNCPP
PYYMLTYGMGGLIALSGLDLINHKFNKMLCISPLFAPFGNKTNSFQHKLTQLLSDIGLGF
LPAKGGEKLKQKSTQFMRINEAALSSDFLIKRPTSRWMASVLNAIDSVKKNILNGHLEIP
TLFILANQNNIANNIEIRQLCQYTHLTDSITITGAELDTIMHEESYQKQFWIAFDAFIRG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagatctctttattccccagacttgagaattcctcctgccaatatccataataac
caccttaaaatagacactgatcgcaaaattcgttttgcgataacacatcccgaaataaaa
aaagccaaaggaacaattgttattcttgaaagctatgcaaatgctttagaagaatatttt
ttaccaatgaatgaaatttccaaccgcggtttttacacagcaatatttgattggtttggt
cgagaagaatcgcaacccgataaacaaaaacagagtcgatataattattttaatattaac
aatgatattaatgacttaaatgagtttcttaaaaatattgtttattgtaattgtccacca
ccttactacatgctaacttatggcatggggggactgatagcacttagcggattggatctc
attaaccataagtttaataaaatgctctgcatttctcccctttttgctccatttggcaat
aaaacaaatagctttcaacataaattaacacaacttctttctgatatcggtcttggattt
ttaccagcgaaaggtggggaaaaattaaaacaaaaaagtacgcaatttatgcgcatcaat
gaagcagctttatcctctgattttcttataaaacgtccgacatctcgatggatggcatca
gtactcaatgcaattgatagcgtgaaaaaaaatatccttaatgggcatttagaaattcca
acattgtttattcttgccaaccaaaacaatatagccaataacattgaaatacgacaatta
tgccaatatacgcatctgacagacagtattacaattacaggtgccgaacttgataccatc
atgcatgaagaaagttaccaaaaacaattttggattgcatttgatgcatttattcgtgga
tga

DBGET integrated database retrieval system