KEGG   Bartonella henselae: BH07290Help
Entry
BH07290           CDS       T00180                                 

Definition
lysophospholipase l2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bhe  Bartonella henselae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bhe00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(840745..841647)
Genome map
AA seq 300 aa AA seqDB search
MERSLYSPDLRIPPANIHNNHLKIDTDRKIRFAITHPEIKKAKGTIVILESYANALEEYF
LPMNEISNRGFYTAIFDWFGREESQPDKQKQSRYNYFNINNDINDLNEFLKNIVYCNCPP
PYYMLTYGMGGLIALSGLDLINHKFNKMLCISPLFAPFGNKTNSFQHKLTQLLSDIGLGF
LPAKGGEKLKQKSTQFMRINEAALSSDFLIKRPTSRWMASVLNAIDSVKKNILNGHLEIP
TLFILANQNNIANNIEIRQLCQYTHLTDSITITGAELDTIMHEESYQKQFWIAFDAFIRG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagatctctttattccccagacttgagaattcctcctgccaatatccataataac
caccttaaaatagacactgatcgcaaaattcgttttgcgataacacatcccgaaataaaa
aaagccaaaggaacaattgttattcttgaaagctatgcaaatgctttagaagaatatttt
ttaccaatgaatgaaatttccaaccgcggtttttacacagcaatatttgattggtttggt
cgagaagaatcgcaacccgataaacaaaaacagagtcgatataattattttaatattaac
aatgatattaatgacttaaatgagtttcttaaaaatattgtttattgtaattgtccacca
ccttactacatgctaacttatggcatggggggactgatagcacttagcggattggatctc
attaaccataagtttaataaaatgctctgcatttctcccctttttgctccatttggcaat
aaaacaaatagctttcaacataaattaacacaacttctttctgatatcggtcttggattt
ttaccagcgaaaggtggggaaaaattaaaacaaaaaagtacgcaatttatgcgcatcaat
gaagcagctttatcctctgattttcttataaaacgtccgacatctcgatggatggcatca
gtactcaatgcaattgatagcgtgaaaaaaaatatccttaatgggcatttagaaattcca
acattgtttattcttgccaaccaaaacaatatagccaataacattgaaatacgacaatta
tgccaatatacgcatctgacagacagtattacaattacaggtgccgaacttgataccatc
atgcatgaagaaagttaccaaaaacaattttggattgcatttgatgcatttattcgtgga
tga

DBGET integrated database retrieval system