KEGG   Bartonella henselae: BH07690Help
Entry
BH07690           CDS       T00180                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bhe  Bartonella henselae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bhe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880923..881543
Genome map
AA seq 206 aa AA seqDB search
MHNIKVGTKNPFLSGRKRPPFEEVEAAIRTFLLWIGENPNREGLLDTPGRVAKAYRDLFT
GYDESVEEILGTVFEEVSGYNEPVIMKDLSFYSHCEHHMIPIVGKAHIAYFPDEKIVGLS
KIARVVNVFSRRLQTQEAMTAQIANALETHLKPRGVAVLIEAEHMCMTMRGVQKQGAKTI
TTSFHGSYEKDQVAQAHFMMIVRRSS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcataatattaaagtaggtactaaaaacccttttttatctgggaggaagcgccctcct
tttgaagaagtggaagcggcgattcgtacatttttgttatggataggggaaaatccaaac
cgagaagggcttttagacactccagggcgggtcgctaaggcatatcgtgatctttttacc
gggtatgacgagtcggttgaagaaatcttgggaacggtttttgaagaggtttcaggctac
aatgaaccagtaatcatgaaagatctctctttttattcacattgtgaacatcatatgatc
ccaattgttggtaaagctcatatcgcttattttcctgatgaaaagattgttggtctttca
aaaattgcacgggtggtaaacgttttttcgcgtcggttacagacacaagaagctatgaca
gctcaaatagctaatgctttggaaacacatctaaaacctcgtggtgttgcagtgttaatt
gaggctgaacacatgtgtatgactatgagaggagtacaaaaacaaggagctaaaacgatt
acgacaagttttcatggctcttatgaaaaggatcaagttgcacaggctcattttatgatg
atagtgcgtagatcatcttaa

DBGET integrated database retrieval system