KEGG   Bartonella henselae Houston-1: BH10660Help
Entry
BH10660           CDS       T00180                                 

Gene name
pcm2
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bhe  Bartonella henselae Houston-1
Brite
Enzymes [BR:bhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BH10660 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172256..1172930)
Genome map
AA seq 224 aa AA seqDB search
MVADFAELRRKMVDNQIRTVDVTDLSVLEAFLMVPREDFVPENMKALSYLDTDILLYPAQ
EGVPACYLMGPAPLAKLLQLAAVKSSDIVLDIGANGGYCAALLSKLARSVIALEAHKALL
ERTASTLERNQCNNVVVVHGALEQGYAVEGPYDVIFIEGSVDFIPKIIFDQMKDGGRLVV
VEGHGNAGVALIYVKEDGIISARRAFNLAVKRISGFLKTPDFIF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagatttcgcagagcttcgccggaaaatggtcgacaatcaaattcgtacagtg
gatgtgacggatttatcagttcttgaagcgtttttaatggtaccgcgtgaagattttgta
ccggaaaatatgaaagctttgagttatctcgataccgatattcttctatatccagcgcag
gagggagttcctgcgtgctatttgatgggacctgcgcctttagctaaattgctacagctt
gccgctgtaaaatcatcggatattgtgttagatattggggctaatggtggttattgtgca
gcattgctttcaaaacttgcgcgttctgttattgcgttagaagctcataaagctctttta
gaacgaactgcctcgactttagaacgtaatcaatgtaacaatgtggttgtggttcatgga
gcattggagcagggctatgccgttgagggtccttatgatgtgatttttattgagggttct
gtcgattttatcccaaagattatctttgatcagatgaaagatggggggcgtcttgttgtg
gttgaaggacacggtaacgcaggtgttgctctaatctatgtaaaagaagatggaattatt
tctgcgcgtcgtgcttttaatctggctgtaaaacgtatttctggttttttaaagacgcct
gattttatattttag

DBGET integrated database retrieval system