KEGG   Bartonella henselae Houston-1: BH11400Help
Entry
BH11400           CDS       T00180                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase pncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bhe  Bartonella henselae Houston-1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BH11400 (pncA)
Enzymes [BR:bhe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BH11400 (pncA)
    3.5.1.-  
     BH11400 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258257..1258865
Genome map
AA seq 202 aa AA seqDB search
MEKKALIVIDIQNDFLPGGALAVPQSDIILPAVNNLIEHFDHVILTQDWHPKNHCSFASS
YPDKKPYDSVNLDYGPQILWPDHCVQGTKGADFHTSLKVDKAQLILRKGYNQKIDSYSAF
FENDQKTPTGLQVYLKEHGFTKLAMCGLATDFCVSFSALHAIQCGFKVSVSLNACAGIDV
NGSLNTMLKTMNEAGIELLMAS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagctttaattgttattgatattcaaaatgactttttaccaggtggagca
ttggcagtaccacaaagtgatatcattttaccggctgtcaataatctcatagagcatttt
gatcatgttattttaacccaagactggcaccctaaaaaccattgcagcttcgcctcttcc
taccctgataaaaagccttatgatagcgttaatcttgactatggtccgcaaatactgtgg
ccagatcattgcgtacaaggaacaaaaggagcagactttcatacctctcttaaagttgat
aaagcacaactcatcctcagaaaaggctataatcaaaaaattgatagttattccgccttt
tttgaaaatgatcaaaaaacaccaacaggcttacaagtttatctgaaagaacatggtttt
acaaagctcgctatgtgcggcttagcaacggatttttgtgttagtttctctgcacttcac
gccatacaatgcggttttaaagtgagtgtttcattaaatgcctgtgctggtattgatgta
aatggatcactgaacacaatgctaaaaaccatgaacgaagctggcatagaactcctaatg
gcctcctaa

DBGET integrated database retrieval system