KEGG   Bartonella henselae Houston-1: BH15410Help
Entry
BH15410           CDS       T00180                                 

Gene name
acs
Definition
(GenBank) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe00010  Glycolysis / Gluconeogenesis
bhe00620  Pyruvate metabolism
bhe00640  Propanoate metabolism
bhe00680  Methane metabolism
bhe01100  Metabolic pathways
bhe01110  Biosynthesis of secondary metabolites
bhe01120  Microbial metabolism in diverse environments
bhe01130  Biosynthesis of antibiotics
bhe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH15410 (acs)
   00620 Pyruvate metabolism
    BH15410 (acs)
   00640 Propanoate metabolism
    BH15410 (acs)
  Energy metabolism
   00680 Methane metabolism
    BH15410 (acs)
Enzymes [BR:bhe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BH15410 (acs)
Lipid biosynthesis proteins [BR:bhe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BH15410 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAF28304
UniProt: Q6G1W0
Position
1778773..1780731
Genome map
AA seq 652 aa AA seqDB search
MSEKIYPIPDNIKKNALIDEETYQQWYQESINDPESFWAKHGQCIEWFKPYTKVKNTSFN
GDVSIQWYEDGITNVAYNCIDRHLKTHGDKIALIWEGDNPYHDKKITYNELYEHVCRFAN
ILKNHGVKKGDKVTIYLTMIPEAAYAMLACARIGAIHSVIFAGFSPEAIAGRIVDCESTF
IITANQGLRGGKQINLKDSVDHAIEIAARQNVHVDQVMVIRRTCGPIHWVEGRDFWYHEE
VSHTKTDCPAEKMNAEDPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHKYVFDYHAGEI
YWCTADIGWITGHSYLVYGPLCNAATTLMFEGTPTFPDNGRFWEIVDKHQVNIFYTAPTA
IRALMGAGNSFVERSKRTSLRLLGSVGEPINPEAWEWFYHTVGNNHCPILDTWWQTETGG
HMITPLPGATPLKAGSATRPFFGVQLQIIDAEGNVLEGETEGNLCIIDSWPGQMRTLYND
HERFIQTYFSTYKGKYFTGDGCRRDSDGYYWITGRVDDILNVSGHRLGTAEIESALVSHP
AVSEAAVVGYPHTIKGQGIYSFITLMEGTAPSEELHQELIRHVRKEIGSIAILDKVQFAP
QLPKTRSGKIMRRILRKIAENNFDNLGDISTLSEPQVIDDLIANRQNREITA
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaatctacccaataccggataatatcaaaaaaaatgctttgatcgatgaa
gaaacctatcaacaatggtatcaggaaagcatcaatgatccagaaagtttctgggcaaaa
catggtcaatgtattgaatggtttaaaccttatacaaaagtaaaaaatacttcctttaat
ggcgatgtatcgattcaatggtatgaagatggcataacaaatgttgcctataactgcatt
gatcgccacctaaaaacccatggtgataaaatcgcactgatttgggaaggagataaccct
tatcacgataaaaagataacctataatgaactttatgaacatgtctgtcgttttgccaat
attttaaaaaatcacggtgtcaaaaaaggcgataaggttaccatttacctaaccatgatc
cctgaagcagcctatgcaatgctagcctgtgcccgtattggcgctattcattcggttatt
tttgcaggtttttctcctgaagcaatagcaggacgcattgtagactgcgaatcgactttt
atcattaccgcaaatcaaggcttgcgtggaggaaaacagattaatttaaaagacagtgtt
gaccatgctattgagattgccgctcgccagaatgtgcatgtggatcaagtcatggtcata
cggcgaacctgtggaccaatccattgggtagagggacgtgatttttggtatcatgaagaa
gtatctcataccaaaacggactgtccagcagaaaagatgaatgctgaagatccacttttt
attctttatacctcaggctcaacaggtaaacccaaaggtgttttgcatacaacagcgggc
tatcttgtttatgcatcaatgacccataaatatgtttttgattatcatgctggtgaaatt
tactggtgtactgctgatattggttggatcaccggccattcttatttggtttatggtcct
ctttgcaacgctgctactactttaatgtttgaaggcacaccaacctttcccgacaacggc
agattctgggaaattgtcgataaacatcaagtcaatatattctacaccgcaccaacagct
attcgcgccttaatgggtgcgggcaattcatttgttgaacgctcgaaaagaacatccttg
cgtcttttagggtccgtgggcgaacccattaatccagaggcatgggaatggttttaccac
acagttggaaacaatcattgccccattctcgatacatggtggcaaacagaaacaggagga
catatgatcacccccctccccggtgcgacaccccttaaagcaggatcagccacacgtcct
ttttttggagtacaactccaaatcatagatgcagaaggaaatgtcctagaaggtgaaaca
gaaggcaatctttgtattattgattcatggccaggacaaatgcgcacactctataatgat
cacgagcgctttattcaaacttatttttccacctataaagggaaatattttacaggcgat
ggctgtaggcgcgatagcgatggctattattggattacaggacgagtggatgacattctc
aatgtttctggacacagactaggaacagcagaaattgaatcagcgcttgtttcgcatccc
gctgtttcagaagccgccgttgttggctaccctcatactattaaaggacaaggaatttac
agttttatcaccttaatggaagggacagccccaagtgaagagttgcatcaagagcttatc
cgacatgtcagaaaggaaataggctccattgccatattggataaagttcaatttgctcct
cagctccccaaaacgcgatcaggaaaaattatgagacggattttgcgaaaaattgccgaa
aataattttgataatctaggagatatttccactctttctgaaccacaagtcattgatgat
cttattgctaatcgtcaaaacagagaaattacagcgtaa

DBGET integrated database retrieval system