KEGG   Bartonella henselae Houston-1: BH16530Help
Entry
BH16530           CDS       T00180                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe00020  Citrate cycle (TCA cycle)
bhe00310  Lysine degradation
bhe01100  Metabolic pathways
bhe01110  Biosynthesis of secondary metabolites
bhe01120  Microbial metabolism in diverse environments
bhe01130  Biosynthesis of antibiotics
bhe01200  Carbon metabolism
Module
bhe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bhe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bhe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BH16530 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BH16530 (sucB)
Enzymes [BR:bhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BH16530 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RTX_C
Motif
Other DBs
NCBI-ProteinID: CAF28414
UniProt: A0A0R4J7U2
Position
complement(1907854..1909074)
Genome map
AA seq 406 aa AA seqDB search
MTTEIRVPTLGESVTEATVGKWFKKLGEAVAVDEPLIELETDKVTVEVPSPVAGKLSEII
AKEGDTVEVKALLGLVEAGAAGISQSFSPSATPIPEVPSELKQSSSSGAMQKDTMPPSPS
AAKLMAENNIAKSNISGSGKRGQILKEDVLGVLEQEVKAPSVSAASSSASLVQEKHEERV
RMTKLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMDLRKRYKDLFEKKHGVKLGFMGFFT
KAVCHALKELPAVNAEIDGTDIVYKNYVNVGIAVGTDKGLVVPVVRHADQMSLAEIEKEI
GRLGRLARDGKLAVSDMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHAIKERAMVVG
GQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLEDPERLVLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactactgaaatccgtgttcctactttaggcgaatcagttactgaggcgacagttggt
aagtggtttaaaaagcttggcgaagctgtggctgtggatgaacccttgattgaattagaa
actgataaggtaaccgttgaggttccttcgcctgttgcaggaaaattatctgaaatcatc
gcaaaagaaggtgatacggttgaagtaaaagctctgttaggattagtggaagctggagct
gctggtatttcccaatcattttcaccttctgctacgcctattccagaagtgccatctgaa
ttgaagcagtcttcttccagtggtgcaatgcagaaagatacaatgccgccctctccttca
gcagcaaaattgatggctgaaaataatattgcaaaaagcaatatttcaggttctggaaaa
cgtggacaaatcctcaaagaagatgttcttggtgtcttagaacaagaagtaaaagcgcca
tctgtttctgcagcttcctcttcggcttctcttgttcaagaaaagcatgaagagcgggtt
cgtatgacaaaattgcgtcaaacaattgcgcgtcgtcttaaagatgcacagaatacagca
gcaatgttaactacatttaatgaggttgatatgtcggctgtgatggatttgcgcaagcgt
tataaggatctttttgaaaagaaacatggtgttaaactcggctttatgggattttttacc
aaggctgtttgtcatgcattaaaagaacttcctgctgttaatgcggaaattgatggaacg
gatattgtttacaaaaattacgtcaatgttggaattgctgttggaacggataaaggactt
gtcgttccggtagtgcgtcatgcagatcagatgtcgttagcagagattgaaaaggaaatt
ggtcgtttggggcgtcttgctcgtgatggaaaattagcggtttctgatatgcaaggtgga
acttttaccattaccaatgggggtgtttatggttcgttaatgtcgacaccgattttaaat
gcaccacagtccggtatcttgggaatgcacgcgattaaagaacgagcaatggttgttggc
gggcaaatagtcattcgccccatgatgtatctggcgctttcatatgatcaccgtattgta
gatggacaagaggctgtcactttccttgtgcgtgttaaggaaagtttagaagatccggaa
cgcctggttcttgacttgtaa

DBGET integrated database retrieval system