KEGG   Bacillus horikoshii: B4U37_20575Help
Entry
B4U37_20575       CDS       T04904                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00071  Fatty acid degradation
bhk00072  Synthesis and degradation of ketone bodies
bhk00280  Valine, leucine and isoleucine degradation
bhk00310  Lysine degradation
bhk00362  Benzoate degradation
bhk00380  Tryptophan metabolism
bhk00620  Pyruvate metabolism
bhk00630  Glyoxylate and dicarboxylate metabolism
bhk00640  Propanoate metabolism
bhk00650  Butanoate metabolism
bhk00900  Terpenoid backbone biosynthesis
bhk01100  Metabolic pathways
bhk01110  Biosynthesis of secondary metabolites
bhk01120  Microbial metabolism in diverse environments
bhk01130  Biosynthesis of antibiotics
bhk01200  Carbon metabolism
bhk01212  Fatty acid metabolism
bhk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bhk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B4U37_20575
   00630 Glyoxylate and dicarboxylate metabolism
    B4U37_20575
   00640 Propanoate metabolism
    B4U37_20575
   00650 Butanoate metabolism
    B4U37_20575
  Lipid metabolism
   00071 Fatty acid degradation
    B4U37_20575
   00072 Synthesis and degradation of ketone bodies
    B4U37_20575
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B4U37_20575
   00310 Lysine degradation
    B4U37_20575
   00380 Tryptophan metabolism
    B4U37_20575
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B4U37_20575
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B4U37_20575
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B4U37_20575
Enzymes [BR:bhk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B4U37_20575
Exosome [BR:bhk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B4U37_20575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Aminotran_5 ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ART78295
UniProt: A0A1Y0CTV8
Position
complement(4071476..4072654)
Genome map
AA seq 392 aa AA seqDB search
MGKTVIVSGVRTPIGRFAGGLSSLTASDLGAVAIKEALSRANVSGDQVGEVIMGTVLQGG
QGQLPSRQASQKAGLPWEVRTETINKVCASGMRSVTLGDILIRSGEEEVIVVGGMESMSN
APYMLPKARWGLRMGDSTVQDLMVHDGLTCTFTGVHMGTYGNSVAKEMEITREDQDAWAF
RSHQRAIEATEKGTFYAEIVPVSVPHRKGDPIVVSKDESPRKDTSIEKLASLRPAFDHDG
TITAGNAPGVNDGASALVLMSEDRAAKEGKEVLATILGHASIAVEAKDFPKTPGLVITEL
LKKTGTKLEDIDLFEINEAFAAVALASANLAGLDLEKVNVNGGAVALGHPIGASGARIIV
SLIHELKRRGGGLGIASICSGGGQGDAILVQV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaacagtaatcgttagtggagtaagaacaccaatcgggcgtttcgcaggagga
ctaagctcactcacagcctcagacctaggagcagtcgccatcaaagaagcactatcaaga
gcaaacgtatcaggcgaccaagtaggcgaagtcatcatgggcaccgtcctacaaggaggc
caaggccaactgccatcccgccaagcctcccaaaaagcaggactgccatgggaagtacgc
accgaaaccatcaacaaagtttgtgcatccggcatgcgcagcgtcacactcggtgacatc
ctcatccgctccggggaagaagaagtcatcgtagtaggcggaatggaatccatgagcaac
gcgccatacatgctgccaaaagcaagatggggactgcgtatgggcgacagcaccgtgcaa
gacttgatggtccatgacggcctaacttgtaccttcacaggcgtgcacatgggcacatac
ggaaacagcgtcgcaaaagaaatggaaatcacccgtgaagaccaggatgcatgggcgttc
agaagtcaccagagagccatcgaagcaacagaaaaaggtacattttatgcagagatcgtc
ccagtttccgtcccgcatcgaaaaggcgatccgatcgtcgtgagcaaggatgagtctcca
cgtaaagatacatctattgagaaactggcaagcttgcgaccggcatttgaccatgacggc
acgataacggcaggaaacgcaccaggagtgaatgacggagcaagtgcgcttgtgttgatg
agcgaagaccgcgcggcaaaagaaggaaaagaagtgcttgcgactatcctaggccacgcg
tccatcgcagtggaagcaaaggatttcccgaaaacgccggggcttgtcatcaccgaactt
ttaaagaaaacaggtacaaagcttgaagatatcgatctttttgaaataaatgaagcgttc
gcagcggtagcgttggcatcggctaaccttgctggactggacctcgagaaagtgaatgtg
aacggcggggcagttgcactcggacatccgatcggggcaagtggagcacgtatcatcgtg
tcgttaattcatgaattaaaacgccgcggcggcggtctgggaattgcttctatctgctca
ggcggcggacagggtgatgcaattttggttcaagtataa

DBGET integrated database retrieval system