KEGG   Bacteroides helcogenes: Bache_0004Help
Entry
Bache_0004        CDS       T01393                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bhl  Bacteroides helcogenes
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bache_0004
Enzymes [BR:bhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bache_0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5266..7971
Genome map
AA seq 901 aa AA seqDB search
MILSFNIEYRTSWGEEVRVSGSIPELGNDRSNDAIPLSTIDGIHWNAKVDIQSPEHSIIR
YCYHIYRDGKVIRTEWNSFSRTLHVEGTPKKIYRIEDNWKNLPEQQYFYSSAFTESLLAH
HERSAAPKSYKRGVLIKAYAPCINSDHCLAICGNQKVLGDWNPDKAILMSDTAFPEWQVE
VDASKISFPLEYKFILFNKKEHRAVAWENNPNRYIANPQIGTDETLAIGDRYVYFSLPPW
KGAGVAVPVFSLRSEKSFGVGDFGDLIRIIDWAVATHQKAVQILPINDTTMTHTWTDSYP
YNSISIYAFHPMYMDLQQLGKLKDKSLMTEFNRRQKELNTFPTVDYEAVNRTKWEYFHLI
YKQEGEKVLASEAFKTFYKTNKEWLQPYAVFSYLRDAYKTPNFREWPKYSIYNIRETEKL
CEPTSADYPHIAIYYYIQFNLHLQLLAATEHARANGVVLKGDIPIGISRNSVDAWTEPHY
FNLNGQAGAPPDDFSVNGQNWGFPTYNWDIMEKDGYAWWMKRFRKMSEYFDAYRIDHILG
FFRIWEIPMDAVHGLLGQFVPALPMTREEIEGYGLTFRYEYLKPYIHEHFLKQVFGPHTE
TVKQIFIEPTDTWEIYRMRPEFDTQRKVEAYFAGKTDEDSIWIRDGLYALISDVLFVPDR
SDANKYHPRIGVQHDYIYRALNDWEKAAFNRLYDQYYYHRHNDFWGQQAMKKLPQLTQST
RMLVCGEDLGMIPDCVAWVMNDLRILSLEIQRMPKDPSQEFGYPDQYPYRSVCTISTHDM
STLRGWWEEDFQQTQRYYNTILGHYGAAPAIATPELCEEVIRNHLYSNSILCILSLQDWM
SIDGKWRNPNVQEERINIPANPRHYWRWRMHLTLEQLMNAESLNEKIKSLIGNTQREIIP
I
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgatactatcatttaatattgaataccgcaccagttggggtgaagaagtcagagtttct
ggctccattcccgaacttggcaacgatcgttcaaacgacgccattcctctaagtaccata
gacggcattcattggaatgccaaagtagatatacagtcaccggaacacagtattatccgg
tactgttaccatatttatcgtgacggaaaggtcatacgtacggaatggaacagtttttcc
cgcactctccatgtggaaggcactccaaagaagatctatcgcatagaggataactggaaa
aatttaccggaacaacagtatttctattcctccgcattcacagaatctttgttggcacac
cacgagcgcagtgcagctcccaaaagctataaaagaggagtgctgattaaagcatatgct
ccgtgcattaacagtgaccactgtttggctatttgcggtaaccaaaaagtactgggagac
tggaatccggataaagccatactaatgagcgatactgcttttccagaatggcaagtagag
gtagatgccagtaaaatcagtttccctttagaatacaagtttattcttttcaacaaaaaa
gaacaccgcgccgtagcttgggaaaataatcccaatcgctatatagccaacccgcaaata
ggaaccgacgaaacattggcaataggtgaccgttatgtttacttcagccttcctccctgg
aaaggtgctggtgtagccgtaccggtattctctctacgttctgaaaaaagttttggagtg
ggcgatttcggtgatttgatacgcataatcgactgggcagtagctactcatcaaaaagct
gtacaaattctgcctatcaatgacactaccatgacacatacatggacagactcttatccc
tacaacagcatttctatctatgctttccatccgatgtacatggatttacaacaattggga
aagttgaaagacaagagtctaatgacagaattcaacagacgacagaaagaattgaacacc
tttcctactgtagattatgaagccgtaaaccggacgaaatgggagtatttccatttgatt
tacaaacaagagggcgaaaaagttttggcatcggaagctttcaaaacattttataagacc
aataaggaatggctgcaaccatacgctgtattcagttacttacgggatgcctataaaact
ccaaactttcgtgaatggcccaaatacagcatatacaatattcgggagactgaaaaactt
tgcgaaccgacatccgccgattaccctcatattgccatttactattatatccaattcaac
ctccatctacaactacttgccgccacagaacatgcacgtgccaatggtgtggtactgaaa
ggtgacattcccataggcataagccgtaatagcgtagatgcatggacagagccccattat
ttcaacttaaacggtcaggccggtgctccacccgatgacttctctgtaaacggacagaac
tggggttttcctacttacaactgggacataatggaaaaagatggttatgcctggtggatg
aagcgcttccgcaagatgtcggaatactttgatgcctatcgtatagaccacatcctcggc
ttcttccgtatttgggaaataccgatggatgccgtacatgggttgttgggacaatttgta
ccggccttacctatgacacgtgaagaaattgaagggtacggtctgacattccgatacgag
tatctgaaaccttatatccacgaacacttcctcaaacaagtattcggtccccatacagaa
acggtaaaacagatatttatcgagccaacagacacatgggaaatttaccgtatgcgtccg
gagttcgacacccagcgcaaggttgaagcatactttgccggaaaaactgatgaagacagc
atttggattcgagacggtctgtatgcacttatcagtgatgtgttgtttgttcctgaccgg
agcgacgccaacaaataccatccccgtatcggtgtacaacacgattacatctaccgtgcc
ttgaacgattgggaaaaggctgcattcaaccgcctatatgaccaatactattatcaccgc
cacaatgatttctgggggcaacaggccatgaagaaactgccccagctcacacaatccaca
cgtatgctggtatgtggagaagacctcggaatgattcccgactgtgtggcatgggtaatg
aatgatttacgcatcctttctctggaaatacagcgtatgcccaaagacccatctcaggag
ttcgggtatccagaccaatatccgtatcgctcagtctgcactatttccacacacgacatg
tccaccctacgtggctggtgggaagaagatttccaacagacgcaacgatattataacact
atattggggcattacggtgctgcccccgccatagctacgcctgaactttgtgaagaagtg
attcgcaaccacctgtacagcaactctatcctctgcatcctatctctgcaagattggatg
tcaatagacggcaaatggcgcaatccaaatgtacaggaggagcgtatcaacatccctgcc
aacccacgccactactggcgttggcgcatgcatttgacactggaacagttaatgaacgcc
gagagtctgaatgaaaaaatcaaaagtctgataggcaatactcagagagaaattatccca
atatga

DBGET integrated database retrieval system