KEGG   Bacteroides helcogenes: Bache_0026Help
Entry
Bache_0026        CDS       T01393                                 

Definition
glycoside hydrolase 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bhl  Bacteroides helcogenes
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bhl00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bhl00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bhl00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(31466..34612)
Genome map
AA seq 1048 aa AA seqDB search
MRKGVVCRHKEFIKFSSMNKHFITGLFTVMALTANAQSFNEWRDSEVNAVNRAPMHTNYF
AYESVDAASRGVKEQSSNFMTLNGTWKFFWVKDADARPVDFWKQGFNDKGWSNMPVPGVW
ELNGFGDPIYVNVGYAWRNQFKNNPPQVPVENNHVGSYRREIVVPADWKDKDIVAHFGSV
TSNMYLWVNGRYVGYSEDSKLEAEFDLTPYLKPGQKNLIAFQVFRWCDGTYLEDQDFFRY
SGVGRNCYLYARDKKRIEDIRVIPDLDADYKDGSLRVTLNLKGSGNVGMELLDATGKQVA
AETMHGSGTVVMNVENPHKWTAETPYLYTLRAILQGSGEVIPVKVGFRKIELKDSQILVN
GQPVLFKGADRHEMDPDGGYVVSPERMMQDIQIMKQFNLNAVRTCHYPDDNLWYDLCDKY
GIYVVAEANVESHGMGYGDKTLAKNPAYKKAHLERNRRNVQRGFNHPSIIFWSLGNEAGY
GANFEAAYDWVKAEDPSRAVQYEQAGRKGKTDIFCPMYYSYDACRKYCEDASADKPLIQC
EYAHAMGNSEGGFKEYWDLVRKYPKYQGGFIWDFVDQSVRWTGKNGKMIYAYGGDFNRFD
ASDGNFCDNGLISPDRVPNPHMYEVGRIYQNIWTTPSDLKNGEINVFNEYFFRDLSAYYL
EWEVLKGGKVIRTGRVDDLNIAPRQTSKIKLDLGKICQCEEWLLNISYKLKNREGLLPAG
HAVAKDQLTLNPYKASAMELKNMEIPNIPVMAPQVQDSDWAYLIVSNDAFRVEISKRSGY
LTKYEVDGVDMIKEGEALTPNFWRAPTDNDFGAGLQRRYAAWKKPEMKLISFNHRTENDL
VVAEAVYDMPSVSAALSLTYVINNAGAIKVTQKMTTDKNAKISNMFRFGMQMPMPRSFET
VEYYGRGPVENYIDRNHAADLGIYRQSVSEQFYSYIRPQENGTKTDIRWWKMLNAAGRGI
QVTAGAPFSASALHYTIESLDEGLEKRQWHSPEVEESDLTNFCIDKVQMGLGCEDSWGRI
ARPEYLLPYGDYEFTFLLSPVKNAIDLE
NT seq 3147 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaggagttgtgtgccgtcacaaagaatttattaaatttagtagcatgaataaa
catttcattaccggattgttcaccgttatggctttgacggcaaatgcgcagtccttcaac
gaatggcgtgattctgaagttaacgccgtgaaccgtgctccgatgcacactaactatttt
gcttacgaatcggttgacgccgcgagccgtggagtaaaagagcagtcatccaactttatg
accttgaacggtacatggaaatttttctgggtgaaggatgccgatgcccgtcctgtagat
ttttggaagcaagggtttaatgataaggggtggagcaatatgcccgttcccggggtatgg
gagctgaacggctttggtgatcctatctatgtgaatgtgggctatgcctggcgtaatcaa
ttcaagaataatcctccccaagtgcctgtggaaaacaaccatgtcggttcttatcgccgt
gagattgtagtgcctgccgactggaaggacaaagatatcgtggcacacttcggttctgtt
acttccaatatgtatctgtgggtaaacggtcgctatgtgggctatagtgaagacagcaag
ctggaagcggaattcgacctgactccctatttgaagcccggtcagaaaaatctgattgct
tttcaggtattccgttggtgtgacggtacttatttggaagatcaggacttttttcgttac
agtggtgtagggcgtaattgctacctttatgcccgtgataagaaacggattgaagatatc
cgtgtgattcccgatctggatgcagattacaaggacggttctttacgtgtaacacttaat
ttgaagggaagcggcaacgtcggtatggaattgcttgatgcaacaggcaagcaagttgcg
gcagagacgatgcatggcagtggcacggttgtgatgaatgtggagaatccacataaatgg
acagcggagactccttatctctatactttgcgtgccattcttcagggaagtggagaagtg
attcccgtgaaagtgggcttccgcaagattgaactgaaagactctcaaattctggtcaat
gggcagcctgtcctgttcaaaggagccgaccgtcacgagatggatcctgatgggggatat
gtagtttcgcccgaacgtatgatgcaggacatccagatcatgaaacagttcaatctcaat
gctgtgcgtacctgccattatcctgacgataacctctggtatgacctttgtgacaagtac
ggaatctatgtagtggctgaagccaatgtagaatcgcatggaatgggttatggcgacaag
acgcttgccaagaatccggcctacaaaaaggcgcatctggagcgtaaccgacgcaatgtg
caacgcggctttaatcatcccagcatcatcttttggtcattgggcaatgaagccggatat
ggtgctaactttgaggcagcctatgattgggtgaaggcggaagatccgagccgggcggtg
cagtatgaacaggcgggcaggaagggtaaaactgatattttctgcccgatgtattatagc
tatgacgcttgcaggaaatattgtgaggacgcttctgccgacaagcctctgattcaatgt
gaatatgcccacgccatgggtaattctgaaggcggcttcaaggaatattgggacttggtt
cgcaaatatcccaagtatcaggggggattcatttgggattttgtggatcagtctgtacgc
tggacaggtaagaatggtaagatgatttatgcttatggcggtgatttcaaccgttttgat
gccagcgatggaaacttctgtgacaatggacttataagccccgaccgtgtgcccaatcct
cacatgtatgaggtggggcgtatctatcaaaacatctggaccactccctccgatctgaaa
aacggtgaaatcaatgtattcaacgaatatttcttccgtgatctttctgcctattatctg
gaatgggaagtgctgaaaggcggcaaggtgatacgtaccggtcgtgtggatgatttgaat
attgctccgcgacagacatccaaaattaaactggatttgggcaaaatctgccaatgtgag
gaatggctgctcaacatctcctataaattgaagaaccgtgaaggattgctgcctgccgga
catgctgtggcaaaggatcaattgactctgaatccttataaagcttccgcaatggaactg
aagaatatggaaattcccaatattcctgtcatggctccgcaagtacaggatagcgactgg
gcctatctcattgtctctaatgatgccttccgcgtcgagatcagcaaacgtagcggttat
ctgacaaaatatgaagtggatggtgtggatatgattaaagaaggagaggctctgactccc
aacttctggcgtgctcctacggacaatgatttcggcgccggtttgcagcgcagatatgct
gcctggaaaaagccggagatgaagttgatttctttcaatcatcgtacggaaaatgatctg
gttgtcgcagaagcggtctatgacatgccgtctgtatcggctgcgctgagcttgacttat
gtcattaataatgccggtgctatcaaggtcactcagaagatgacgacagacaagaatgca
aaaatatccaatatgttccgttttggtatgcagatgccgatgccgcgtagctttgaaacc
gtggaatattacggtcgtggccccgtagagaattacatcgatcgcaaccatgcggccgat
ctcggcatttatcgtcaaagcgtatccgaacagttctattcttacatccgtccacaggag
aacggtacgaaaaccgacatacgttggtggaagatgctgaatgccgccggtagaggcatt
caggtgacggctggcgctccgttctccgcatctgccctgcactatactatcgagtcgctg
gatgaaggtttggaaaagcggcaatggcactcccccgaagtggaagaatctgatcttacc
aacttctgcattgataaagtgcagatgggattgggttgcgaagacagttggggacgaatt
gcccgcccggaatatttgttgccttatggcgattatgaatttacgttcctcctttctccg
gtgaagaatgccatagatctggaataa

DBGET integrated database retrieval system