KEGG   Bacteroides helcogenes: Bache_0065Help
Entry
Bache_0065        CDS       T01393                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00052  Galactose metabolism
bhl00500  Starch and sucrose metabolism
bhl00520  Amino sugar and nucleotide sugar metabolism
bhl00521  Streptomycin biosynthesis
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
bhl01200  Carbon metabolism
Module
bhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_0065
   00052 Galactose metabolism
    Bache_0065
   00500 Starch and sucrose metabolism
    Bache_0065
   00520 Amino sugar and nucleotide sugar metabolism
    Bache_0065
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bache_0065
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bache_0065
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bache_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase Glucokinase Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ADV42095
UniProt: E6SRT6
Position
complement(93376..94203)
Genome map
AA seq 275 aa AA seqDB search
MKLAIDLGGTNIRIAQVENARCLNKMSIACLAQQDASAVLSQLFQLIEGMMNEQVNGIGI
GVPSIVDPEKGIVYNVANISSWKEIHLKAILEKKFGVPVAINNDSNCFALGESLFGEGKP
YANMVGVTIGTGIGAGVIVNRRLYCGQYMGAGEIGSFPYQDTDFEHYCSSFFFKRYDTTG
AAAAEKAEKGNQAALKIWKEFGLHLGNLVKVILFAYAPQAIVLGGGIVSAFPFFRETMEG
EMKDFPYKVILDELKVIPSQKEDISLLGASALLDN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcaattgatttaggaggaaccaatataaggattgcccaagtggaaaatgcc
aggtgtctgaacaaaatgtcaatagcttgcctggcgcagcaggatgcttctgcggtactt
agtcagcttttccaactgattgaaggcatgatgaatgaacaggtgaatggcatcggaata
ggtgttccttccattgttgatccggaaaaagggatagtatataatgtggcgaatatttct
tcctggaaagaaattcatttgaaagcgattttggagaagaagtttggagtgccggttgcc
attaataacgattctaattgtttcgctttgggtgaaagcctgttcggtgaaggtaagcca
tacgccaatatggtgggtgttaccattggaacaggtatcggagcaggagttattgtgaat
cgtcgtttgtattgcggacaatacatgggagccggtgagatagggtcgttcccatatcag
gatactgattttgaacattattgcagcagtttcttctttaagcgatatgatacgacggga
gcagcggcagccgaaaaagcggagaaaggaaaccaagccgcattgaaaatctggaaagaa
ttcgggctgcatctgggcaatctggtaaaagtaatcctttttgcctatgctcctcaagct
attgttttaggcggaggcattgtgtcggcttttcctttcttcagagagacgatggaaggt
gaaatgaaagactttccttacaaagtcatcttggatgagttgaaagtgattccatctcaa
aaagaagatattagtttgctgggagcttctgctttgctggataactga

DBGET integrated database retrieval system