KEGG   Bacteroides helcogenes: Bache_0080Help
Entry
Bache_0080        CDS       T01393                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00051  Fructose and mannose metabolism
bhl00562  Inositol phosphate metabolism
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
bhl01200  Carbon metabolism
bhl01230  Biosynthesis of amino acids
Module
bhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bhl_M00002  Glycolysis, core module involving three-carbon compounds
bhl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_0080
   00051 Fructose and mannose metabolism
    Bache_0080
   00562 Inositol phosphate metabolism
    Bache_0080
Enzymes [BR:bhl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bache_0080
Exosome [BR:bhl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bache_0080
  Exosomal proteins of bladder cancer cells
   Bache_0080
  Exosomal proteins of melanoma cells
   Bache_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV42110
UniProt: E6SRV1
Position
complement(113733..114488)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGIALAKELNEALADGKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKVSGAYTGEVSAAMVASTGAQYVILGHSERRAYYGETVAILEEKVKLALEN
NLTPIFCIGEVLEEREANKQNEVVAAQLASVFSLSAEDFSKIILAYEPVWAIGTGKTATA
AQAQEIHAFIRSTVAEKYGKEIADNCSILYGGSCKASNAKELFANPDVDGGLIGGAALKV
ADFKGIIDAFN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgttgcaggaaactggaaaatgaacaaaacccttcaggagggtatt
gctcttgcaaaagaactgaatgaagcactggctgatggaaagcctaattgtgatgtaatc
atctgtacgccatttattcatctggcatctgttactccgttggttgatgctgccaagatc
ggtgtaggtgcagagaactgcgcagataaagtatctggtgcttataccggtgaagtatct
gccgctatggttgcttctacaggagctcagtacgtaatcttaggtcactcggaacgtcgt
gcttactatggtgaaacagtagctatcttggaagaaaaagtaaaattggctttggaaaac
aatctgactccgattttctgtattggcgaagttttggaagaacgtgaagcaaataagcag
aatgaggtagttgcagctcagcttgcatctgtattctctttgtctgccgaagatttctcc
aagattatcctggcatatgagccggtttgggctattggtactggcaagactgccactgct
gcccaggctcaggaaatccatgcttttatccgttcaacagtagcagagaaatatggtaag
gaaatagcagacaattgttctatcctttatggcggtagctgtaaggcttctaatgctaag
gaattgtttgcaaatccggatgttgacggtggcttgattggtggtgctgctttgaaggtt
gctgacttcaaggggatcattgacgctttcaattaa

DBGET integrated database retrieval system