KEGG   Bacteroides helcogenes: Bache_0080Help
Entry
Bache_0080        CDS       T01393                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bhl  Bacteroides helcogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bache_0080
   01230 Biosynthesis of amino acids
    Bache_0080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_0080
   00051 Fructose and mannose metabolism
    Bache_0080
   00562 Inositol phosphate metabolism
    Bache_0080
Enzymes [BR:bhl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bache_0080
Exosome [BR:bhl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bache_0080
  Exosomal proteins of bladder cancer cells
   Bache_0080
  Exosomal proteins of melanoma cells
   Bache_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(113733..114488)
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGIALAKELNEALADGKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKVSGAYTGEVSAAMVASTGAQYVILGHSERRAYYGETVAILEEKVKLALEN
NLTPIFCIGEVLEEREANKQNEVVAAQLASVFSLSAEDFSKIILAYEPVWAIGTGKTATA
AQAQEIHAFIRSTVAEKYGKEIADNCSILYGGSCKASNAKELFANPDVDGGLIGGAALKV
ADFKGIIDAFN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacattgttgcaggaaactggaaaatgaacaaaacccttcaggagggtatt
gctcttgcaaaagaactgaatgaagcactggctgatggaaagcctaattgtgatgtaatc
atctgtacgccatttattcatctggcatctgttactccgttggttgatgctgccaagatc
ggtgtaggtgcagagaactgcgcagataaagtatctggtgcttataccggtgaagtatct
gccgctatggttgcttctacaggagctcagtacgtaatcttaggtcactcggaacgtcgt
gcttactatggtgaaacagtagctatcttggaagaaaaagtaaaattggctttggaaaac
aatctgactccgattttctgtattggcgaagttttggaagaacgtgaagcaaataagcag
aatgaggtagttgcagctcagcttgcatctgtattctctttgtctgccgaagatttctcc
aagattatcctggcatatgagccggtttgggctattggtactggcaagactgccactgct
gcccaggctcaggaaatccatgcttttatccgttcaacagtagcagagaaatatggtaag
gaaatagcagacaattgttctatcctttatggcggtagctgtaaggcttctaatgctaag
gaattgtttgcaaatccggatgttgacggtggcttgattggtggtgctgctttgaaggtt
gctgacttcaaggggatcattgacgctttcaattaa

DBGET integrated database retrieval system