KEGG   Bacteroides helcogenes: Bache_0254Help
Entry
Bache_0254        CDS       T01393                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00052  Galactose metabolism
bhl00500  Starch and sucrose metabolism
bhl00520  Amino sugar and nucleotide sugar metabolism
bhl00521  Streptomycin biosynthesis
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
bhl01200  Carbon metabolism
Module
bhl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_0254
   00052 Galactose metabolism
    Bache_0254
   00500 Starch and sucrose metabolism
    Bache_0254
   00520 Amino sugar and nucleotide sugar metabolism
    Bache_0254
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bache_0254
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bache_0254
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bache_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DUF460 DEDD_Tnp_IS110 Type_III_YscG SPOB_a
Motif
Other DBs
NCBI-ProteinID: ADV42284
UniProt: E6STT1
Position
complement(357368..358348)
Genome map
AA seq 326 aa AA seqDB search
MNSSMEKPYVVGIDIGGTNTVFGIVDARGTIIASGSIKTGAYEQVEEYVDEVCKNLLPLI
IANGGVDKIKGIGIGAPNGNYYSGTIEFAPNLPWKGVIPLAAMFEERLGIPTALTNDANA
AGIGEMTYGAARGMKDFIMITLGTGVGSGIVINGQMVYGHDGFAGELGHTIIRRENGRLC
GCGRHGCLETYCSATGVARSAREFLAARTEPSLLRSIPAENITSKDVYDAAVKGDKLAQD
IFEFTGTILGEALADFIAFSSPEAIILFGGLAKSGEYIFKPIQKAIDANILTIYKGKTKL
LASELKDSDAAVLGASALGWELRDIK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaagcatggaaaagccttatgtggtaggcattgacataggcggaacaaatacc
gtctttggtattgtggatgcacgcggaactattattgcaagtggctctatcaaaacagga
gcctatgagcaggttgaagaatatgtggatgaagtatgcaagaatctgcttcctctgatt
attgccaacggtggtgtggataagataaagggcatcggtattggtgcaccaaatggcaac
tattacagtggaaccatcgaatttgccccgaaccttccgtggaaaggagtgattcctctg
gctgccatgttcgaagagcgtcttggcattcccactgcattgaccaatgatgccaatgca
gccggtatcggcgagatgacctatggtgctgcgcgcggtatgaaagatttcatcatgatt
actcttggcacgggtgtgggtagcggtatcgtcatcaacggccagatggtttacggtcac
gacggctttgccggagagttggggcataccataatccgtcgtgaaaacggccgtctttgc
ggatgcgggcgtcacggctgtctggaaacctattgctcggctacgggggtagcccgttcg
gcgcgcgagtttcttgctgcccgtacggaacccagtttgttgcgttccatacctgccgag
aacatcacttccaaggatgtgtatgacgccgccgtcaaaggtgacaagcttgcgcaggat
atctttgaattcacgggaacgatcttgggtgaggctttggccgactttatcgctttctcc
agtcccgaagccattattctgttcggtggtttggctaagtccggtgaatatatcttcaag
cccatacagaaggcgatcgatgccaatatactgacaatttacaaaggtaaaaccaaactg
ctggcttccgagttgaaggattctgacgctgcggtgctgggagccagtgcactggggtgg
gaattgagagacatcaagtag

DBGET integrated database retrieval system