KEGG   Bacteroides helcogenes: Bache_0352Help
Entry
Bache_0352        CDS       T01393                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00730  Thiamine metabolism
bhl00790  Folate biosynthesis
bhl01100  Metabolic pathways
bhl02020  Two-component system
Module
bhl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Bache_0352
   00790 Folate biosynthesis
    Bache_0352
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bache_0352
Enzymes [BR:bhl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bache_0352
Exosome [BR:bhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bache_0352
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bhl00537]
 Enzymes
  Bache_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ADV42381
UniProt: E6SUG3
Position
complement(457997..459394)
Genome map
AA seq 465 aa AA seqDB search
MKRLMYLLFFVLLTGAAHAQQAKYVFYFIGDGMGVNQVNGTEMYLAEKEGRIGIKPLLFA
TFPVAGVATTFSATNSITDSAAAGTALSTGVKTYNSAICMDGDKNVLQTVAEKAKKAGKK
VGVTTSVSVDHATPASFYAHQPSRSMYYEIALDLPKADFDFYAGSGFLKPTTTADKQEAP
SIFPIIEEAGYTIARGLEEYKAKEADAKKMVLIQKEGAEPSCLPYAIDRREGDLTLAEIT
ESAVSFLTKGSNKGFFLMVEGGKIDWACHSNDPATAFEEVVDMDNAVKVAYEFYKKHPKE
TLIVITADHETGGLGLGTSKYELHLKSLTNQKESQDMLSRSITDLRKMRKIINWEEVKSL
LGEKMGFWKELPLTWEQEKMLRDAYEESFVKKNVVFEESLYAKTEPLAAAARKVMSQIAM
VGWTSPNHTAGYVPVYAIGAGSNLFAGKMDNTDIPKRIAKAAGYK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattaatgtatctgttgttttttgtactgttgacgggcgctgcacatgctcaa
caggcaaaatatgtgttttatttcatcggtgatggaatgggagtaaaccaggtgaacggt
acagaaatgtatcttgccgagaaagaagggcgtatcggtataaaacctttattgttcgct
acatttcccgtagccggtgtggctaccactttctccgccaccaattccattaccgactct
gcggctgccggaacggctctttccacaggagtgaagacttataattccgccatctgtatg
gacggtgacaagaatgttctccagacggttgccgaaaaagccaagaaagcaggaaagaaa
gtcggtgtcaccaccagtgtaagtgtggatcatgccactcctgcttcattttatgcgcat
cagcccagtcgcagcatgtactacgaaatagctcttgaccttccgaaagcggatttcgat
ttctatgcaggcagcggcttcctgaaaccgaccacgactgccgacaagcaagaagctccg
agcattttccctattatcgaagaagctggttataccattgccagagggcttgaagaatat
aaagcgaaagaagcagatgccaagaaaatggtacttatccaaaaagaaggtgcagaacct
tcctgccttccctatgccatcgaccgcagagaaggtgacctgaccctggccgagattacg
gaaagtgccgtatcctttttgacaaagggaagcaataagggctttttcctcatggtggag
ggcggaaagattgactgggcttgccacagcaatgatcctgccacggcttttgaggaagta
gtggatatggacaatgccgttaaagtggcttatgaattctataagaaacaccccaaagag
acgctgattgtgattactgccgaccatgaaaccggtggtctggggctggggacttccaag
tatgaactgcacttgaagtctttgactaaccagaaagaatcacaggatatgctttcacgt
tccattaccgacttgcgcaagatgcgtaaaatcatcaattgggaagaagtgaagtctctg
cttggcgagaagatgggattctggaaagaattgccgttgacatgggaacaggaaaagatg
ctccgtgatgcttatgaggagtctttcgtaaagaaaaatgtggtgtttgaagaaagtctt
tatgccaagaccgaaccgcttgcagccgcagcccgcaaagtgatgagccagattgctatg
gtaggatggacaagtcctaaccatacagcagggtatgtgccggtatatgcgataggagca
ggttcaaacctgtttgcaggcaagatggacaatacggatattccgaaacgtatagcaaaa
gctgccggatataaataa

DBGET integrated database retrieval system