KEGG   Bacteroides helcogenes: Bache_0367Help
Entry
Bache_0367        CDS       T01393                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00790  Folate biosynthesis
bhl01100  Metabolic pathways
Module
bhl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bache_0367
Enzymes [BR:bhl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Bache_0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADV42396
UniProt: E6SUW0
Position
complement(476515..477399)
Genome map
AA seq 294 aa AA seqDB search
MDARKASYINVNGQLLDLSMPCVMGILNVTPDSFYEGSRMRTEKEIACRVEQIIAEGAVM
IDIGAYSSRPNAENVSPREEMERLRMGLGILRNVQPEAVVSVDTFRADVARMCVEEYGVA
IINDIAAGEMDADMFRTVARLNVPYIMMHMQGTPQNMQQHPHYDNLLKDVFLYFARKVQQ
LHDLGVKDIILDPGFGFGKTVEHNYELLAHLEEFRIFELPLLVGVSRKSMIYRLLDITPQ
EALNGTTVLDTVCLLKGANILRVHDVREAVETVKIVEMMNRCGDGTFHHATCER
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacggaaagcaagttacataaatgtcaacggtcagttgcttgacctttctatg
ccttgtgtcatgggcatattgaatgtcacacccgattctttttatgaaggcagccgcatg
cggacggaaaaagagattgcatgccgggtggagcaaatcatcgccgaaggagccgtaatg
attgatataggggcttactcgtcacgtcccaatgcagagaacgtatcgccccgggaagaa
atggagcgtttgcgcatgggacttggcatcctccgcaatgtacagccggaagcggttgtt
tctgtcgatacttttcgtgcggacgttgcccgcatgtgtgtggaggaatatggagttgcg
attatcaatgatatcgctgccggagagatggacgccgacatgttccgtaccgttgcccgg
ctgaatgtaccctatataatgatgcacatgcagggtactccgcaaaatatgcagcagcat
cctcattatgacaatctgctgaaagatgtcttcctgtattttgcgcgcaaggtgcagcag
ttgcatgatttgggagtgaaggatattattctggaccccggattcggctttggcaagacg
gtggaacacaattatgaactgctggcccatctggaggaattccgtatttttgagctgcct
ttgttggtgggagtttcgcgcaagtcgatgatttatcgtttgctggacattacacctcag
gaagcgctgaacggaaccactgtgctggataccgtatgcttgctgaaaggagcgaatata
ctgcgcgtgcatgacgtgcgtgaagctgtggaaacggtgaaaatcgtggaaatgatgaac
agatgcggagacggcacatttcatcatgctacctgcgaaagatga

DBGET integrated database retrieval system