KEGG   Bacteroides helcogenes: Bache_0556Help
Entry
Bache_0556        CDS       T01393                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00030  Pentose phosphate pathway
bhl00051  Fructose and mannose metabolism
bhl00052  Galactose metabolism
bhl00680  Methane metabolism
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_0556
   00030 Pentose phosphate pathway
    Bache_0556
   00051 Fructose and mannose metabolism
    Bache_0556
   00052 Galactose metabolism
    Bache_0556
  Energy metabolism
   00680 Methane metabolism
    Bache_0556
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bache_0556
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Bache_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF1611 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADV42581
UniProt: E6SWI3
Position
complement(736561..737571)
Genome map
AA seq 336 aa AA seqDB search
MRIGILTSGGDCPGINATIRGVCKTAINHYGMEVIGIHSGFQGLLTKDVESFTEKSLSGL
LNLGGTMLGTSREKPFKKNGVMPDVDKPALIEQNVKDLGLDCIVCIGGNGTQKTAAKLAN
MGLNIVSVPKTIDNDIWGTDFSFGFDSAVSIATDAIDRLHSTASSHKRVMVIEVMGHKAG
WIALYSGMAGGGDVILIPEIPYDIHNIGETILNRLKKGKPYSIVVVAEGIQTDGNKRAAE
YIAQEIEYETGIETRETVLGYIQRGGSPTPFDRNLSTRMGGHATELIATGQFGRMITLKG
NEIASVPLEEVAGKLKLVTEDHDLVVQGRRMGICFG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcggtattttgacctcaggaggcgactgtcccggcatcaatgctacgatacgt
ggcgtatgcaaaacagccatcaatcattatggaatggaagtaataggcattcacagtggt
tttcagggactgttgactaaagatgtggagtcatttaccgaaaaatccttatctggtttg
ctgaatttaggcggcacgatgctgggaacttcccgtgagaagccattcaagaagaatgga
gtgatgcctgatgtggataaacccgcgctgatagaacaaaacgtgaaagatctgggttta
gactgcatcgtctgtatcggaggaaacggtactcagaagacggcggcaaaacttgcgaat
atgggcttgaatattgtttccgtgccaaaaaccattgataatgacatttggggaaccgac
ttctctttcggtttcgattctgccgtcagcattgccaccgatgctattgacaggctgcac
tctaccgccagctcgcacaaacgcgtgatggtgattgaggtaatgggacataaggcgggc
tggatagctctttactccggcatggcgggaggaggtgacgtgatcctgatacctgagata
ccttatgacattcacaatattggcgagacaatactgaaccgcctcaaaaaaggcaaaccc
tattccattgtagttgttgccgaaggcattcagacagacggaaacaagcgtgccgccgaa
tacatagctcaggagatagagtacgaaacagggatagaaacccgcgaaaccgtgctggga
tatatccagcgtggcggttcgcctacacctttcgaccgtaacctctctacccgcatggga
ggccatgctacggaactgattgctaccggacaattcgggcgcatgattactttgaaaggg
aacgaaatagcttctgttcccttagaggaggtggccggtaagttgaagttggtgacggaa
gaccatgacttagttgtccagggacgcaggatgggaatctgtttcggataa

DBGET integrated database retrieval system