KEGG   Bacteroides helcogenes: Bache_0752Help
Entry
Bache_0752        CDS       T01393                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bhl  Bacteroides helcogenes
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bache_0752
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bache_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1003067..1003546
Genome map
AA seq 159 aa AA seqDB search
MNIYFSLGTNLGDKDRNLRIAVQEIEKRIGKIVSLSAFYATAPWGFTSENTFLNAALSVE
TAHLPLEVLKITQEIEREMGRLHKSVDGVYGDRVIDIDFLLCFADDGTPVSLNTSELKLP
HPLMQERLFVMEPLAEIAPDIIHPIFKETMRELLKKVLS
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttatttcagtcttggtactaacctcggtgataaggatcggaatctgcgtatt
gccgttcaggaaatagaaaagcggatagggaaaattgtttccctttccgctttttatgct
acggctccgtggggatttacttcagagaatacctttcttaatgcagcccttagcgtggag
acggcgcatcttcctttggaggtgctgaaaatcacacaagagatagagcgtgagatgggg
aggctccataaatccgtggatggagtatatggtgacagggtgatagacattgacttcttg
ctttgttttgccgatgacggcacacctgtatcattaaacacctctgaactgaaacttccc
catccgttgatgcaggagcgactttttgttatggagcctttggcggagattgcaccggat
attatacatccgatatttaaagagacgatgcgtgagttgctgaaaaaggttttatcttga

DBGET integrated database retrieval system