KEGG   Bacteroides helcogenes: Bache_0760Help
Entry
Bache_0760        CDS       T01393                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bhl  Bacteroides helcogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bhl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1010490..1011242
Genome map
AA seq 250 aa AA seqDB search
MKIKKVLVSQPKPASEKSPYYDIAEKYGVKIDFRPFIKVESLSSKEFRQQKVSILDYTAV
VFTSRHAIDHFFHLCTELRVTIPETMKYFCVSEAIALYIQKYVQYRKRKIFFGSTGKFDD
LLPSIVKHKTEKYLVPMSDVHTDEIKSLLDKSKVQHTEVVMYRTVSNDFGTDEKFDYDML
IFFSPAGVSSLKKNFPDFEQKEIKIGTFGSTTAQAVRDAGLRLDLEAPSVQAPSMTAALD
MFIKENNKGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattaagaaagtacttgtgtcgcagccgaaaccggcatcagagaaatctccttac
tacgacatcgccgaaaagtatggtgtgaaaatagattttcgcccgttcatcaaagtggag
agtctttcatcgaaagaattcagacaacagaaggtatccatattggattatacggctgtt
gttttcacatcgcgtcatgctattgaccactttttccatctttgtacagaactgcgtgtg
acgatacctgaaaccatgaagtatttctgcgtgtcggaagccattgccttgtacattcaa
aaatacgtgcaataccgcaagcgtaagattttcttcggaagcaccgggaagtttgatgac
ttattgccttccatcgtaaagcataagactgagaaatacctggttcctatgtctgatgtg
catacggatgagataaaaagcctgctggacaaaagtaaggttcagcatactgaggttgtc
atgtatcggactgtcagcaatgacttcggtacggatgagaagtttgattatgatatgctg
atattcttcagccctgcgggggtctcttctttaaagaagaattttccggattttgagcaa
aaagagataaaaatcggaacattcggctctacgaccgcacaggctgtccgcgatgccgga
cttcgtttggatttggaggctcccagcgtacaagctccttctatgacggctgcacttgat
atgtttatcaaggagaataataaaggaaagtga

DBGET integrated database retrieval system