KEGG   Bacteroides helcogenes: Bache_0893Help
Entry
Bache_0893        CDS       T01393                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bhl  Bacteroides helcogenes
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bhl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bhl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1162030..1162983)
Genome map
AA seq 317 aa AA seqDB search
MKKYLLTIAWALVALTIVNAQNNQERMGKTVRLIYPQWQGGNVSSLITEVKNPDDASLGY
MLGAQLLEVLAPQNPAQKKITIPISTEIGERKVQDGVYDRDIIAQQTSVAVEMLKIEKPD
RIITLGGECSVSVAPFTFLADKYKNDVAVVWIDAHPDITLPGEAYPGYHAMAVTALMGKG
DNKILSSLPTSIAPSNILFVGLRDWERDEIKVRQREYGMKNLTVQEVKVDSKAVLNWIKQ
TGAKHILIHFDMDVLDPSEIIPAVGVVNNGLKMSEVVRIINDIHAHAQIDALTVAEPMPR
IAINLRNMLRAIKMFEE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatctattaaccatcgcatgggcacttgttgcgttgacaattgtaaatgca
caaaacaatcaagaaagaatgggaaaaacagtaagattgatttatcctcaatggcaaggg
ggcaacgtttcttcgttgattacggaagtcaagaatccagatgatgcttcattgggctat
atgcttggggcacaattgttggaagtattggctcctcaaaatcctgcacagaaaaaaata
actatacctatatcgacagaaataggcgaacgcaaagtgcaggatggtgtttatgaccgt
gatataattgcacaacaaacaagtgtagccgttgaaatgctaaagatagaaaagccagac
cgaatcataactcttggtggagaatgctctgtaagtgttgctccatttacttttcttgca
gataaatataaaaatgatgttgccgtagtgtggattgatgcacatccagacattacgctt
cctggagaagcttatcctggataccatgctatggctgttactgccctcatgggaaaaggc
gataataaaatcctttcttcattgcccaccagcatagctccatcaaatatcctatttgta
gggctacgcgattgggaacgtgatgaaattaaagtacgccaaagagaatatggaatgaaa
aatctaacagttcaagaagtgaaggtcgatagtaaagctgtgctgaattggataaaacaa
acaggagcaaagcatattcttattcactttgatatggatgtgttagacccttctgaaata
attccggcggtcggtgttgtaaataatggcttgaagatgtctgaagttgttagaattatc
aatgatattcatgctcatgctcaaattgacgcattgactgtagcagagccaatgccaaga
atagcaatcaatctaagaaatatgttgagagccattaaaatgtttgaagagtaa

DBGET integrated database retrieval system